DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dscam1 and Kirrel3

DIOPT Version :9

Sequence 1:NP_001246162.1 Gene:Dscam1 / 35652 FlyBaseID:FBgn0033159 Length:2038 Species:Drosophila melanogaster
Sequence 2:XP_038937320.1 Gene:Kirrel3 / 315546 RGDID:1311382 Length:869 Species:Rattus norvegicus


Alignment Length:717 Identity:165/717 - (23%)
Similarity:259/717 - (36%) Gaps:167/717 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   440 QEETMEPGPSVFLKCVAGGNPTPE----ISWELDGKKI-ANNDRYQVGQYVTVNGDVVS---YLN 496
            |::.:..|..|.|.|.     .||    :.|..||..: ...|.....||:.| |:.:|   :|.
  Rat    55 QDQVVVSGQPVTLLCA-----IPEYDGFVLWIKDGLALGVGRDLSSYPQYLVV-GNHLSGEHHLK 113

  Fly   497 ITSVHANDGGLYKCIAKSKVGVAEHSAKLNV---------YGLPYIRQMEKKAIVAGETLIVTCP 552
            |......|..:|:|.| .:..:....|:|.|         .|.|.|      ::.||:.|.:||.
  Rat   114 ILRAELQDDAVYECQA-IQAAIRSRPARLTV
LVPPDDPIILGGPVI------SLRAGDPLNLTCH 171

  Fly   553 V-AGYPIDSIVWERDNRA----------LPINRKQKVFPNGTLIIENVERNSDQATYTCVAKNQE 606
            . ...|..||:|.|....          |...:::.:.  .||.|...:..:.| :..|.|.|: 
  Rat   172 ADNAKPAASIIWLRKGEVINGATYSKTLLRDGKRESIV--STLFISPGDVENGQ-SIVCRATNK- 232

  Fly   607 GYSARGSLEVQVMV---LPQIVPFAYEDLINMGDSIDLF-CQIQKGDRPIKVHWS---------- 657
              :..|..|..|.:   .|.:|..:.|....:.|:|..| |..:......:..|:          
  Rat   233 --AIPGGKETSVTIDI
QHPPLVNLSVEPQPVLEDNIVTFHCSAKANPAVTQYRWAKRGHIIKEAS 295

  Fly   658 --FERSAGDYGFDQVQPQMRTNRISEKTSMISIPSASPAHTGRDTCIASNKAGTTTYSVDLTVNV 720
              ..|:..||.:           .||..|                |..:|..|:|..|..:.|..
  Rat   296 GELYRTTVDYTY-----------FSEPVS----------------CEVTNALGSTNLSRTVDVYF 333

  Fly   721 PPRWILEPTDKAFAQGSDAKVECKADGFPKPQVTWKKAVGDTPGEYKDLKKSDNIRVEEGTLHVD 785
            .||...||.......||||...|...|.|...:.|.|            :.|..:...|.||.:.
  Rat   334 GPRMTSEPQSLLVDLGSDAVFSCAWIGNPSLTIVWMK------------RGSGVVLSNEKTLTLK 386

  Fly   786 NIQKTNEGYYLCEA-INGIGSGLSAVIMISVQAPPEFTEKLRNQTARRGEPAVLQCEAKGEKPIG 849
            ::::.:.|.|:|.| :..:|:| ...:.::|..|| .....:.|.|..||...::|..:...|..
  Rat   387 SVRQEDAGKYVCRAVVPRVGAG-EREVTLTVNGPP-IISSTQTQHALHGEKGQIKCFIRSTPPPD 449

  Fly   850 -ILWNMNNMRLDPKNDNRYTIREEILSTGVMSSLSIKRTERSD-SALFTCVATNAFGSDDASINM 912
             |.|:.....|:.....|||:.......||:|:|:|....|:| ..::.|.|.|:||||...|.:
  Rat   450 RIAWSWKENVLESGTSGRYTVETVNTEEGVISTLTISNIVRADFQTIYNCTAWNSFGSDTEIIRL 514

  Fly   913 IVQ----------EVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPLDRYIIEFKRSRASWSEIDR 967
            ..|          |...:|.|:.:....|..|..         ..|...|:.|..:|:..|...|
  Rat   515 KEQGSEMKSGAGLEAESVPMAVIIGVAVGAGVAF---------LVLMATIVAFCCARSQRSTGGR 570

  Fly   968 VIVPGHTTEAQVQKLSPATTYNIR--IVAENAIGTSQSSEAVTIITAEEAPSGKPQNIKVEPVNQ 1030
            ..:.|..||.:.:...|... |::  :.|:|.|       .|.|:..|.| ||:      |..:.
  Rat   571 PGISGRGTEQKARLRLPRRA-NLKGVVSAKNDI-------RVEIVHKEPA-SGR------EAEDH 620

  Fly  1031 TTMRVTWKPPPRTEWNGEILGYYVGYKLSNTNSSYVFETINFITEEGKEHNLELQNLRVYTQ--Y 1093
            ||::.....      .||.            ....|.:.:..:.||.|    |.|||:..|.  |
  Rat   621 TTIKQLMMD------RGEF------------QQDSVLKQLEVLKEEEK----EFQNLKDPTNGYY 663

  Fly  1094 SV 1095
            ||
  Rat   664 SV 665

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dscam1NP_001246162.1 Ig 38..130 CDD:299845
IG 57..133 CDD:214652
IG_like 267..343 CDD:214653
Ig 269..340 CDD:143165
IG_like 353..425 CDD:214653
IGc2 361..413 CDD:197706
I-set 433..527 CDD:254352 24/94 (26%)
IGc2 446..517 CDD:197706 21/78 (27%)
I-set 533..618 CDD:254352 21/95 (22%)
IGc2 544..607 CDD:197706 17/73 (23%)
Ig 641..714 CDD:143165 13/85 (15%)
IGc2 735..804 CDD:197706 17/69 (25%)
I-set 819..914 CDD:254352 28/96 (29%)
Ig 833..921 CDD:299845 27/99 (27%)
FN3 918..1011 CDD:238020 20/94 (21%)
FN3 1018..1116 CDD:238020 18/80 (23%)
FN3 1124..1217 CDD:238020
FN3 1222..1312 CDD:238020
Ig 1339..1406 CDD:299845
FN3 1409..1499 CDD:238020
FN3 1504..1584 CDD:238020
Dscam_C 1890..2008 CDD:289151
Kirrel3XP_038937320.1 IG_like 54..143 CDD:214653 24/94 (26%)
Ig strand A' 56..60 CDD:409353 0/3 (0%)
Ig strand B 64..71 CDD:409353 3/11 (27%)
Ig strand C 78..82 CDD:409353 1/3 (33%)
Ig strand C' 84..87 CDD:409353 1/2 (50%)
Ig strand D 97..101 CDD:409353 2/3 (67%)
Ig strand E 104..116 CDD:409353 3/11 (27%)
Ig strand G 132..143 CDD:409353 2/10 (20%)
IgI_2_KIRREL3-like 149..246 CDD:409416 24/108 (22%)
Ig strand B 166..170 CDD:409416 1/3 (33%)
Ig strand C 180..184 CDD:409416 2/3 (67%)
Ig strand E 210..214 CDD:409416 2/3 (67%)
Ig strand F 224..229 CDD:409416 1/4 (25%)
Ig strand G 239..242 CDD:409416 1/2 (50%)
Ig <267..334 CDD:416386 15/93 (16%)
Ig strand B 267..274 CDD:409353 2/6 (33%)
Ig strand C 279..286 CDD:409353 1/6 (17%)
Ig strand C' 288..291 CDD:409353 0/2 (0%)
Ig strand D 298..302 CDD:409353 1/3 (33%)
Ig strand E 304..310 CDD:409353 2/16 (13%)
Ig strand G 321..334 CDD:409353 4/12 (33%)
Ig 335..416 CDD:416386 23/93 (25%)
Ig strand A' 343..347 CDD:409353 0/3 (0%)
Ig strand B 350..360 CDD:409353 4/9 (44%)
Ig strand C 365..371 CDD:409353 2/17 (12%)
Ig strand E 381..387 CDD:409353 2/5 (40%)
IgI_5_KIRREL3 418..515 CDD:409479 29/97 (30%)
Ig strand B 436..440 CDD:409479 0/3 (0%)
Ig strand C 450..454 CDD:409479 1/3 (33%)
Ig strand E 481..485 CDD:409479 2/3 (67%)
Ig strand F 496..501 CDD:409479 1/4 (25%)
Ig strand G 509..512 CDD:409479 0/2 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 54 1.000 Domainoid score I10917
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.900

Return to query results.
Submit another query.