| Sequence 1: | NP_001246162.1 | Gene: | Dscam1 / 35652 | FlyBaseID: | FBgn0033159 | Length: | 2038 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_038944182.1 | Gene: | Lsamp / 29561 | RGDID: | 71102 | Length: | 378 | Species: | Rattus norvegicus |
| Alignment Length: | 314 | Identity: | 83/314 - (26%) |
|---|---|---|---|
| Similarity: | 134/314 - (42%) | Gaps: | 30/314 - (9%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 633 INMGDSIDLFCQIQKGDRPIKVHWSFERSAGDY-GFDQ--VQPQMRTNRISEKTSMISIPSASPA 694
Fly 695 HTGRDTCIASNKAGTTTYSVDLTVNVPPRWILEPTDKAFAQGSDAKVECKADGFPKPQVTWKKAV 759
Fly 760 GDTP--GEYKDLKKSDNIRVEEGTLHVDNIQKTNEGYYLCEAINGIGSGLSAVIMISVQAPPEFT 822
Fly 823 EKLRNQTARRGEPAVLQCEAKGEKPIGILWNMNNMRLDPKNDNRYTIREEILSTGVMSSLSIKRT 887
Fly 888 ERSDSALFTCVATNAFGSDDASINMIVQEVPEMPYALKVLDKSGRSVQLSWAQP 941 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Dscam1 | NP_001246162.1 | Ig | 38..130 | CDD:299845 | |
| IG | 57..133 | CDD:214652 | |||
| IG_like | 267..343 | CDD:214653 | |||
| Ig | 269..340 | CDD:143165 | |||
| IG_like | 353..425 | CDD:214653 | |||
| IGc2 | 361..413 | CDD:197706 | |||
| I-set | 433..527 | CDD:254352 | |||
| IGc2 | 446..517 | CDD:197706 | |||
| I-set | 533..618 | CDD:254352 | |||
| IGc2 | 544..607 | CDD:197706 | |||
| Ig | 641..714 | CDD:143165 | 16/75 (21%) | ||
| IGc2 | 735..804 | CDD:197706 | 21/70 (30%) | ||
| I-set | 819..914 | CDD:254352 | 29/94 (31%) | ||
| Ig | 833..921 | CDD:299845 | 25/87 (29%) | ||
| FN3 | 918..1011 | CDD:238020 | 5/24 (21%) | ||
| FN3 | 1018..1116 | CDD:238020 | |||
| FN3 | 1124..1217 | CDD:238020 | |||
| FN3 | 1222..1312 | CDD:238020 | |||
| Ig | 1339..1406 | CDD:299845 | |||
| FN3 | 1409..1499 | CDD:238020 | |||
| FN3 | 1504..1584 | CDD:238020 | |||
| Dscam_C | 1890..2008 | CDD:289151 | |||
| Lsamp | XP_038944182.1 | Ig | 55..145 | CDD:416386 | 20/87 (23%) |
| FR1 | 55..71 | CDD:409353 | 3/10 (30%) | ||
| Ig strand A' | 56..62 | CDD:409353 | 0/1 (0%) | ||
| Ig strand B | 64..72 | CDD:409353 | 3/7 (43%) | ||
| CDR1 | 72..76 | CDD:409353 | 1/5 (20%) | ||
| FR2 | 77..84 | CDD:409353 | 3/7 (43%) | ||
| Ig strand C | 77..83 | CDD:409353 | 3/6 (50%) | ||
| CDR2 | 85..95 | CDD:409353 | 3/9 (33%) | ||
| Ig strand C' | 87..90 | CDD:409353 | 0/2 (0%) | ||
| Ig strand C' | 92..95 | CDD:409353 | 1/2 (50%) | ||
| FR3 | 96..131 | CDD:409353 | 5/34 (15%) | ||
| Ig strand D | 100..107 | CDD:409353 | 0/6 (0%) | ||
| Ig strand E | 110..116 | CDD:409353 | 0/5 (0%) | ||
| Ig strand F | 123..131 | CDD:409353 | 3/7 (43%) | ||
| CDR3 | 132..136 | CDD:409353 | 0/3 (0%) | ||
| Ig strand G | 136..145 | CDD:409353 | 3/8 (38%) | ||
| FR4 | 138..145 | CDD:409353 | 3/6 (50%) | ||
| Ig_3 | 148..218 | CDD:404760 | 23/81 (28%) | ||
| Ig strand A' | 155..160 | CDD:409353 | 1/4 (25%) | ||
| Ig strand B | 166..173 | CDD:409353 | 1/6 (17%) | ||
| Ig strand C | 179..184 | CDD:409353 | 2/4 (50%) | ||
| Ig strand D | 190..193 | CDD:409353 | 1/2 (50%) | ||
| Ig strand E | 197..203 | CDD:409353 | 1/5 (20%) | ||
| Ig strand F | 210..217 | CDD:409353 | 3/6 (50%) | ||
| Ig strand G | 224..232 | CDD:409353 | 0/7 (0%) | ||
| Ig_3 | 235..311 | CDD:404760 | 26/82 (32%) | ||
| Ig strand B | 252..256 | CDD:409353 | 2/3 (67%) | ||
| Ig strand C | 265..269 | CDD:409353 | 0/3 (0%) | ||
| Ig strand E | 290..294 | CDD:409353 | 3/3 (100%) | ||
| Ig strand F | 304..309 | CDD:409353 | 2/4 (50%) | ||
| Ig strand G | 318..321 | CDD:409353 | 2/2 (100%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 1 | 1.000 | - | - | ||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 3 | 2.810 | |||||