DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dscam1 and CNTN6

DIOPT Version :10

Sequence 1:NP_001246162.1 Gene:Dscam1 / 35652 FlyBaseID:FBgn0033159 Length:2038 Species:Drosophila melanogaster
Sequence 2:NP_055276.1 Gene:CNTN6 / 27255 HGNCID:2176 Length:1028 Species:Homo sapiens


Alignment Length:1169 Identity:275/1169 - (23%)
Similarity:438/1169 - (37%) Gaps:278/1169 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   235 RLVITEPVGSVSPQLSGNGNQEHITLTRVP---------KMGSVTLMCPAQAYPVPFFRWYKFIE 290
            :|||..|:.:.|   :|:|.......|:.|         ....|.|.|.|..||.|.:||.:  .
Human     6 KLVILLPLINSS---AGDGLLSRPIFTQEPHDVIFPLDLSKSEVILNCAANGYPSPHYRWKQ--N 65

  Fly   291 GTTRKQAVVLNDRVKQVSGTLIIKDA-VVEDSGKYLCVVNNSVGGESVETVLTVTAPLS-AKIDP 353
            ||.....:..:.|:.  .|:|.|... ..:|.|.|.|:..|.:|     |:|:..|.|. |.|:.
Human    66 GTDIDFTMSYHYRLD--GGSLAINSPHTDQDIGMYQCLATNLLG-----TILSRKAKLQFAYIED 123

  Fly   354 ------PTQTVDFGRPAVFTC-------------QYTGNPIKTVSWMKDGKA-IGHSEPVLRIES 398
                  .|.:|..|:..|..|             .:..||:..   .:|.:. :......|.|..
Human   124 FETKTRSTVSVREGQGVVLLCGPPPHFGDLSYAWTFNDNPLYV---QEDNRRFVSQETGNLYIAK 185

  Fly   399 VKKEDKGMYQCFVRNDQESAEASAELKLG-------------GRFDPPVIRQAFQEETMEPG--P 448
            |:..|.|.|.||:.|  :.|:.|.:   |             |.::|.:  :....||::..  .
Human   186 VEPSDVGNYTCFITN--KEAQRSVQ---GPPTPLVQRTDGVMGEYEPKI--EVRFPETIQAAKDS 243

  Fly   449 SVFLKCVAGGNPTPEISW-ELDGKKIANNDRYQVGQYVTVNGDVVSYLNITSVHANDGGLYKCIA 512
            ||.|:|.|.|||.|:||| .|||..:....:|...|.:         |.|.:....|.|.|:|||
Human   244 SVKLECFALGNPVPDISWRRLDGSPLPGKVKYSKSQAI---------LEIPNFQQEDEGFYECIA 299

  Fly   513 KSKVGVAEHSAKLNVYGLP-YIRQMEKKAIVAGETLIVTCPVAGYPIDSIVWERDNRALPINRKQ 576
            .:..|......:|..|..| :.::::...:...:.|:..|..:|.|.....|.::...|  |.::
Human   300 SNLRGRNLAKGQLIFYAPPEWEQKIQNTHLSIYDNLLWECKASGKPNPWYTWLKNGERL--NPEE 362

  Fly   577 KV-FPNGTLIIE--NVERNSDQATYTCVAKNQEGYSARGSLEVQVMVLPQIVPFAYEDLINMGDS 638
            :: ..||||||.  ||   ||...|.|.|:|:.                ||: :|..:|..:.  
Human   363 RIQIENGTLIITMLNV---SDSGVYQCAAENKY----------------QII-YANAELRVLA-- 405

  Fly   639 IDLFCQIQKGDRPIKVHWSFERSAGDYGFDQVQPQMRTNRISEKTSMISIPSASPAHTGRDTCIA 703
                                  ||.|:                        |.||.         
Human   406 ----------------------SAPDF------------------------SKSPV--------- 415

  Fly   704 SNKAGTTTYSVDLTVNVPPRWILEPTDKAFAQ-GSDAKVECKADGFPKPQVTWKKAVGDTPGEYK 767
                                     ..|:|.| |.|..:.||.:.||:..::||:..       :
Human   416 -------------------------KKKSFVQVGGDIVIGCKPNAFPRAAISWKRGT-------E 448

  Fly   768 DLKKSDNI-RVEEGTLHVDNIQKTNEGYYLCEAINGIGSGLSAVIMI-----SVQAPPEFTEKLR 826
            .|::|..| .:|:|:|.:.||.:::.|.|.|.|.|..|:..:...:|     .:..||.      
Human   449 TLRQSKRIFLLEDGSLKIYNITRSDAGSYTCIATNQFGTAKNTGSLIVKERTVITVPPS------ 507

  Fly   827 NQTARRGEPAVLQCEAKGEKPIGI--LWNMNNMRLDPKNDNRYTIREEILSTGVMSSLSIKRTER 889
            ......||..||.|:...:..|.:  :|..|...:|.|....:..|....|.|   .|.|:..:.
Human   508 KMDVTVGESIVLPCQVSHDPSIEVVFVWFFNGDVIDLKKGVAHFERIGGESVG---DLMIRNIQL 569

  Fly   890 SDSALFTCVATNAFGSDDASINMIVQEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPLDRYIIE 954
            ..|..:.|.......|..|..::||:..|..|..::|.|.|..:.||||....|.|||:..:.|:
Human   570 HHSGKYLCTVQTTLESLSAVADIIVRGPPGPPEDVQVEDISSTTSQLSWRAGPDNNSPIQIFTIQ 634

  Fly   955 FKRS-RASWSEIDRV--IVPGHTTEAQVQKLSPATTYNIRIVAENAIGTSQSSEAVTII-TAEEA 1015
            .:.. ...|..:..|  |:.|.|..|.|..|||...|..|:||.|:||..:.||...:: |....
Human   635 TRTPFSVGWQAVATVPEILNGKTYNATVVGLSPWVEYEFRVVAGNSIGIGEPSEPSELLRTKASV 699

  Fly  1016 PSGKPQNIKVEPVNQTTMRVTWKPPPRTEWNGEILGYYVGY-----------KLSNTNSS-YVFE 1068
            |...|.||.....:::.:.:||:..|....|||..||.:.:           |:|:..|| :|:.
Human   700 PVVAPVNIHGGGGSRSELVITWESIPEELQNGEGFGYIIMFRPVGSTTWSKEKVSSVESSRFVYR 764

  Fly  1069 TINFITEEGKEHNLELQNLRVYTQYSVVIQAFNKIGAGPLSEEEKQFTAEGTPSQPPSDTACTTL 1133
            ..:.|.               .:.:.|.:..:|..|.|.||.....::.|..|...|..|:..:.
Human   765 NESIIP---------------LSPFEVKVGVYNNEGEGSLSTVTIVYSGEDEPQLAPRGTSLQSF 814

  Fly  1134 TSQTIRVGWVSPPLESANGVIKTYKVVYAPSDEWYDETKRHY--KKTASSDTV---LHGLKKYTN 1193
            ::..:.|.|.:.......|.:..|:|:|     |.|::|...  |...|.:..   :.|||..|.
Human   815 SASEMEVSWNAIAWNRNTGRVLGYEVLY-----WTDDSKESMIGKIRVSGNVTTKNITGLKANTI 874

  Fly  1194 YTMQVLATTAGGDGVRSVPIHCQTEPDVPEAPTDVKALVMGNAAILVSWRPPAQPNGIITQYTVY 1258
            |...|.|....|.|..|.|::..|:...|..|....|..:.|:.:.::|.              :
Human   875 YFASVRAYNTAGTGPSSPPVNVTTKKSPPSQPPANIAWKLTNSKLCLNWE--------------H 925

  Fly  1259 SKAEGAETETKTQKVPHYQMSFEATE-LEKNK-------PYE--FWVTASTTI--GEGQQSKSI 1310
            .|....|:|....|:.:.|.....|. ||.|.       |:|  :.:...|..  |:|..|:.|
Human   926 VKTMENESEVLGYKILYRQNRQSKTHILETNNTSAELLVPFEEDYLIEIRTVSDGGDGSSSEEI 989

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dscam1NP_001246162.1 IgI_1_Dscam 38..136 CDD:409547
Ig strand A 39..42 CDD:409547
Ig strand A' 48..52 CDD:409547
Ig strand B 55..64 CDD:409547
Ig strand C 70..76 CDD:409547
Ig strand C' 78..81 CDD:409547
Ig strand D 87..90 CDD:409547
Ig strand E 95..100 CDD:409547
Ig strand F 113..121 CDD:409547
Ig strand G 124..136 CDD:409547
IgI_2_Dscam 246..343 CDD:409545 28/106 (26%)
Ig strand A 247..250 CDD:409545 0/2 (0%)
Ig strand A' 260..264 CDD:409545 1/3 (33%)
Ig strand B 267..274 CDD:409545 2/6 (33%)
Ig strand C 282..288 CDD:409545 2/5 (40%)
Ig strand C' 294..297 CDD:409545 0/2 (0%)
Ig strand D 303..307 CDD:409545 1/3 (33%)
Ig strand E 309..315 CDD:409545 3/5 (60%)
Ig strand F 322..330 CDD:409545 3/7 (43%)
Ig strand G 333..343 CDD:409545 3/9 (33%)
IgC2_3_Dscam 346..426 CDD:409549 22/100 (22%)
Ig strand A 347..352 CDD:409549 2/5 (40%)
Ig strand A' 355..359 CDD:409549 1/3 (33%)
Ig strand B 362..372 CDD:409549 2/22 (9%)
Ig strand C 377..383 CDD:409549 0/5 (0%)
Ig strand C' 384..387 CDD:409549 0/3 (0%)
Ig strand E 392..398 CDD:409549 2/5 (40%)
Ig strand F 405..413 CDD:409549 4/7 (57%)
Ig strand G 416..426 CDD:409549 2/9 (22%)
IgI_4_Dscam 432..527 CDD:409548 30/97 (31%)
Ig strand A 432..435 CDD:409548 1/2 (50%)
Ig strand A' 441..445 CDD:409548 2/3 (67%)
Ig strand B 448..457 CDD:409548 4/8 (50%)
Ig strand C 462..468 CDD:409548 4/6 (67%)
Ig strand C' 470..473 CDD:409548 1/2 (50%)
Ig strand D 478..486 CDD:409548 2/7 (29%)
Ig strand E 490..499 CDD:409548 2/8 (25%)
Ig strand F 506..514 CDD:409548 5/7 (71%)
Ig strand G 517..527 CDD:409548 2/9 (22%)
IgI_5_Dscam 531..618 CDD:409550 22/90 (24%)
Ig strand A 531..533 CDD:409550 1/2 (50%)
Ig strand A' 538..542 CDD:409550 0/3 (0%)
Ig strand B 545..552 CDD:409550 1/6 (17%)
Ig strand C 559..565 CDD:409550 1/5 (20%)
Ig strand C' 566..568 CDD:409550 0/1 (0%)
Ig strand D 575..579 CDD:409550 0/4 (0%)
Ig strand E 582..588 CDD:409550 5/7 (71%)
Ig strand F 596..604 CDD:409550 3/7 (43%)
Ig strand G 608..618 CDD:409550 0/9 (0%)
Ig 621..718 CDD:472250 10/96 (10%)
Ig strand B 639..643 CDD:409353 0/3 (0%)
Ig strand C 653..657 CDD:409353 0/3 (0%)
Ig strand E 684..688 CDD:409353 0/3 (0%)
Ig strand F 698..703 CDD:409353 0/4 (0%)
Ig strand G 711..714 CDD:409353 0/2 (0%)
IgI_7_Dscam 721..815 CDD:409546 26/100 (26%)
Ig strand A 721..725 CDD:409546 0/3 (0%)
Ig strand A' 730..734 CDD:409546 1/3 (33%)
Ig strand B 737..746 CDD:409546 3/8 (38%)
Ig strand C 752..758 CDD:409546 2/5 (40%)
Ig strand C' 764..767 CDD:409546 0/2 (0%)
Ig strand D 775..778 CDD:409546 1/3 (33%)
Ig strand E 780..786 CDD:409546 2/5 (40%)
Ig strand F 793..801 CDD:409546 4/7 (57%)
Ig strand G 806..815 CDD:409546 1/13 (8%)
Ig 818..916 CDD:472250 23/99 (23%)
Ig strand B 836..840 CDD:409353 2/3 (67%)
Ig strand C 849..853 CDD:409353 0/5 (0%)
Ig strand E 880..884 CDD:409353 1/3 (33%)
Ig strand F 894..899 CDD:409353 1/4 (25%)
FN3 <899..1212 CDD:442628 87/333 (26%)
Ig strand G 907..910 CDD:409353 1/2 (50%)
FN3 1222..1312 CDD:238020 21/101 (21%)
Ig <1339..1406 CDD:472250
Ig strand C 1350..1354 CDD:409358
Ig strand E 1372..1376 CDD:409358
Ig strand F 1386..1391 CDD:409358
Ig strand G 1399..1402 CDD:409358
FN3 1409..1499 CDD:238020
FN3 1504..1584 CDD:238020
Dscam_C 1893..2008 CDD:463546
CNTN6NP_055276.1 Ig 26..120 CDD:472250 27/102 (26%)
Ig strand B 46..50 CDD:409353 2/3 (67%)
Ig strand C 59..63 CDD:409353 1/3 (33%)
Ig strand E 82..86 CDD:409353 2/3 (67%)
Ig strand F 97..102 CDD:409353 2/4 (50%)
Ig strand G 111..114 CDD:409353 0/2 (0%)
Ig 129..214 CDD:472250 20/92 (22%)
Ig strand B 140..144 CDD:409353 1/3 (33%)
Ig strand C 154..158 CDD:409353 0/3 (0%)
Ig strand E 179..183 CDD:409353 1/3 (33%)
Ig strand F 193..198 CDD:409353 2/4 (50%)
Ig strand G 209..212 CDD:409353 1/2 (50%)
Ig 227..315 CDD:472250 30/98 (31%)
Ig strand B 245..249 CDD:409353 2/3 (67%)
Ig strand C 258..262 CDD:409353 2/3 (67%)
Ig strand E 280..284 CDD:409353 1/12 (8%)
Ig strand F 294..299 CDD:409353 2/4 (50%)
Ig strand G 307..310 CDD:409353 0/2 (0%)
Ig 319..403 CDD:472250 25/105 (24%)
Ig strand B 335..339 CDD:409353 1/3 (33%)
Ig strand C 348..352 CDD:409353 0/3 (0%)
Ig strand E 369..373 CDD:409353 3/3 (100%)
Ig strand F 383..388 CDD:409353 2/4 (50%)
Ig strand G 396..399 CDD:409353 1/2 (50%)
Ig5_Contactin 408..496 CDD:409358 29/152 (19%)
Ig strand A 408..413 CDD:409358 2/28 (7%)
Ig strand A' 416..421 CDD:409358 1/4 (25%)
Ig strand B 425..432 CDD:409358 1/6 (17%)
Ig strand C 440..444 CDD:409358 0/3 (0%)
Ig strand D 458..461 CDD:409358 0/2 (0%)
Ig strand E 462..467 CDD:409358 2/4 (50%)
Ig strand F 475..483 CDD:409358 4/7 (57%)
Ig strand G 489..496 CDD:409358 0/6 (0%)
Ig 500..598 CDD:472250 23/106 (22%)
Ig strand B 517..521 CDD:409353 2/3 (67%)
Ig strand C 532..536 CDD:409353 0/3 (0%)
Ig strand E 560..564 CDD:409353 2/6 (33%)
FN3 573..>916 CDD:442628 93/362 (26%)
Ig strand F 574..579 CDD:409353 1/4 (25%)
Ig strand G 587..590 CDD:409353 1/2 (50%)
FN3 598..691 CDD:238020 33/92 (36%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 887..908 6/20 (30%)
FN3 906..991 CDD:238020 20/98 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.