DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dscam1 and LRIT1

DIOPT Version :9

Sequence 1:NP_001246162.1 Gene:Dscam1 / 35652 FlyBaseID:FBgn0033159 Length:2038 Species:Drosophila melanogaster
Sequence 2:NP_056428.1 Gene:LRIT1 / 26103 HGNCID:23404 Length:623 Species:Homo sapiens


Alignment Length:427 Identity:88/427 - (20%)
Similarity:138/427 - (32%) Gaps:126/427 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   736 GSDAKVECKADGFPKPQVTWKKAVGDTPGEYKDLKKSDNIRVEEGTLH--------------VDN 786
            |..|.:.|.|.|.|.|:::|::|.|               |...||:|              :..
Human   268 GGTALLRCGATGVPGPEMSWRRANG---------------RPLNGTVHQEVSSDGTSWTLLGLPA 317

  Fly   787 IQKTNEGYYLCEAINGIGSGLSAVIMISVQAPPEFTEKLRNQTARRGEPAVLQCEAKGEKPIGIL 851
            :...:.|.|:|:|.|.:|:. ..||.:.|..||..||       ..|.|..|.....|.......
Human   318 VSHLDSGDYICQAKNFLGAS-ETVISLIV
TEPPTSTE-------HSGSPGALWARTGGGGEAAAY 374

  Fly   852 WNMNNMRLDPKNDNRYTIREEILSTG--VMSSLSIKRTERSDSALFTCVATNAFGSDDASINMIV 914
            .|....|..|:     ..:..:|:||  |.|:......|.........::....|..:|      
Human   375 NNKLVARHVPQ-----IPKPAVLATGPSVPSTKEELTLEHFQMDALGELSDGRAGPSEA------ 428

  Fly   915 QEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPLDR--YIIEFKRSRASWSEIDRVIVPGHTTEA 977
                .|..::||:..:..||.|.|..|...|:....  |.:..:.|      :.||||....|..
Human   429 ----RMVRSVKVVGDTYHSVSLVWKAPQAKNTTAFSVLYAVFGQHS------MRRVIVQPGKTRV 483

  Fly   978 QVQKLSPATTYNIRIVAENAIGTSQSSEAVTIITAEEAPSGKPQ---NIKVEPV----------- 1028
            .:..|.|.|.|...:..:..:  .:..:.|...|.|...:...|   |:.|..|           
Human   484 TITGLLPKTKYVACVCVQGLV--PRKEQCVIFSTNEVVDAENTQQLINVVVISVAIVIALPLTLL 546

  Fly  1029 ----------------NQTTMRVTWKPPPRTEWNGEILGYYVGYKLSNTNSSYVFETINFITEEG 1077
                            :.|...||:.       |.|.|||                     :|:|
Human   547 VCCSALQKRCRKCFNKDSTEATVTYV-------NLERLGY---------------------SEDG 583

  Fly  1078 KE----HNLELQNLRVYTQYSVVIQAFNKIGAGPLSE 1110
            .|    |::...:..:..:.||..|||...|...::|
Human   584 LEELSRHSVSEADRLLSARSSVDFQAFGVKGGRRINE 620

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dscam1NP_001246162.1 Ig 38..130 CDD:299845
IG 57..133 CDD:214652
IG_like 267..343 CDD:214653
Ig 269..340 CDD:143165
IG_like 353..425 CDD:214653
IGc2 361..413 CDD:197706
I-set 433..527 CDD:254352
IGc2 446..517 CDD:197706
I-set 533..618 CDD:254352
IGc2 544..607 CDD:197706
Ig 641..714 CDD:143165
IGc2 735..804 CDD:197706 19/81 (23%)
I-set 819..914 CDD:254352 18/96 (19%)
Ig 833..921 CDD:299845 15/89 (17%)
FN3 918..1011 CDD:238020 21/94 (22%)
FN3 1018..1116 CDD:238020 23/127 (18%)
FN3 1124..1217 CDD:238020
FN3 1222..1312 CDD:238020
Ig 1339..1406 CDD:299845
FN3 1409..1499 CDD:238020
FN3 1504..1584 CDD:238020
Dscam_C 1890..2008 CDD:289151
LRIT1NP_056428.1 LRR 1 60..81
leucine-rich repeat 61..84 CDD:275378
LRR_8 63..143 CDD:290566
LRR 2 84..105
leucine-rich repeat 85..132 CDD:275378
LRR 3 108..129
LRR_8 131..202 CDD:290566
LRR_4 131..171 CDD:289563
LRR 4 132..153
leucine-rich repeat 133..156 CDD:275378
LRR 5 156..177
leucine-rich repeat 157..180 CDD:275378
leucine-rich repeat 181..205 CDD:275378
TPKR_C2 201..>240 CDD:301599
Ig 267..345 CDD:299845 22/92 (24%)
IG_like 267..345 CDD:214653 22/92 (24%)
FN3 431..498 CDD:214495 19/72 (26%)
LRR 6. /evidence=ECO:0000305 571..594 9/50 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.