Sequence 1: | NP_001246162.1 | Gene: | Dscam1 / 35652 | FlyBaseID: | FBgn0033159 | Length: | 2038 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_776169.2 | Gene: | NEGR1 / 257194 | HGNCID: | 17302 | Length: | 354 | Species: | Homo sapiens |
Alignment Length: | 235 | Identity: | 64/235 - (27%) |
---|---|---|---|
Similarity: | 95/235 - (40%) | Gaps: | 28/235 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 310 TLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPPTQTVDFGRPAVFTCQYTGNP 374
Fly 375 IKTVSWMKDGKAIGHSEP---------VLRIESVKKEDKGMYQCFVRNDQESAEASAELKLGGRF 430
Fly 431 DPPVIRQAFQEETMEPGPSVFLKCVAGGNPTPEISWELDGKKIANNDRYQVGQYVTVNGDVVSYL 495
Fly 496 NITSVHANDGGLYKCIAKSKVGVAEHSAKLN-----VYGL 530 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Dscam1 | NP_001246162.1 | Ig | 38..130 | CDD:299845 | |
IG | 57..133 | CDD:214652 | |||
IG_like | 267..343 | CDD:214653 | 9/32 (28%) | ||
Ig | 269..340 | CDD:143165 | 8/29 (28%) | ||
IG_like | 353..425 | CDD:214653 | 19/80 (24%) | ||
IGc2 | 361..413 | CDD:197706 | 15/60 (25%) | ||
I-set | 433..527 | CDD:254352 | 28/98 (29%) | ||
IGc2 | 446..517 | CDD:197706 | 22/70 (31%) | ||
I-set | 533..618 | CDD:254352 | |||
IGc2 | 544..607 | CDD:197706 | |||
Ig | 641..714 | CDD:143165 | |||
IGc2 | 735..804 | CDD:197706 | |||
I-set | 819..914 | CDD:254352 | |||
Ig | 833..921 | CDD:299845 | |||
FN3 | 918..1011 | CDD:238020 | |||
FN3 | 1018..1116 | CDD:238020 | |||
FN3 | 1124..1217 | CDD:238020 | |||
FN3 | 1222..1312 | CDD:238020 | |||
Ig | 1339..1406 | CDD:299845 | |||
FN3 | 1409..1499 | CDD:238020 | |||
FN3 | 1504..1584 | CDD:238020 | |||
Dscam_C | 1890..2008 | CDD:289151 | |||
NEGR1 | NP_776169.2 | IG | 47..135 | CDD:214652 | 9/32 (28%) |
IGc2 | 152..210 | CDD:197706 | 17/64 (27%) | ||
Ig_3 | 225..301 | CDD:372822 | 24/81 (30%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |