Sequence 1: | NP_001246162.1 | Gene: | Dscam1 / 35652 | FlyBaseID: | FBgn0033159 | Length: | 2038 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001157990.1 | Gene: | Iglon5 / 210094 | MGIID: | 2686277 | Length: | 336 | Species: | Mus musculus |
Alignment Length: | 324 | Identity: | 87/324 - (26%) |
---|---|---|---|
Similarity: | 129/324 - (39%) | Gaps: | 60/324 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 636 GDSIDLFCQIQKGDRPIKVHWSFERSAGDY-GFDQ--VQPQMRTNRISEKTSMISIPSASPAHTG 697
Fly 698 RDTCIASNKAGTTTYSVDLTVNVPPRWILEPTDKAFAQGSDAKVECKADGFPKPQVTWKKAVGDT 762
Fly 763 PGEYKDLKKSDNIRVEEGTLHVDNIQKTNEGYYLCEAINGIGSGL-SAVIMISVQAPPEFTEKLR 826
Fly 827 NQTARRGEPAVLQCEAKGEKPIGILWNMNNMRLDPKNDNRYTIREEILSTGVMSSLSIKRTERSD 891
Fly 892 SAL------------FTCVATNAFGSDDASINM-----IVQEVPEMPYALKVLDKSGRSVQLSW 938 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Dscam1 | NP_001246162.1 | Ig | 38..130 | CDD:299845 | |
IG | 57..133 | CDD:214652 | |||
IG_like | 267..343 | CDD:214653 | |||
Ig | 269..340 | CDD:143165 | |||
IG_like | 353..425 | CDD:214653 | |||
IGc2 | 361..413 | CDD:197706 | |||
I-set | 433..527 | CDD:254352 | |||
IGc2 | 446..517 | CDD:197706 | |||
I-set | 533..618 | CDD:254352 | |||
IGc2 | 544..607 | CDD:197706 | |||
Ig | 641..714 | CDD:143165 | 18/75 (24%) | ||
IGc2 | 735..804 | CDD:197706 | 19/68 (28%) | ||
I-set | 819..914 | CDD:254352 | 30/111 (27%) | ||
Ig | 833..921 | CDD:299845 | 27/104 (26%) | ||
FN3 | 918..1011 | CDD:238020 | 7/21 (33%) | ||
FN3 | 1018..1116 | CDD:238020 | |||
FN3 | 1124..1217 | CDD:238020 | |||
FN3 | 1222..1312 | CDD:238020 | |||
Ig | 1339..1406 | CDD:299845 | |||
FN3 | 1409..1499 | CDD:238020 | |||
FN3 | 1504..1584 | CDD:238020 | |||
Dscam_C | 1890..2008 | CDD:289151 | |||
Iglon5 | NP_001157990.1 | Ig | 41..129 | CDD:416386 | 22/84 (26%) |
Ig strand A' | 41..46 | CDD:409353 | |||
Ig strand B | 48..56 | CDD:409353 | 3/7 (43%) | ||
CDR1 | 56..60 | CDD:409353 | 1/5 (20%) | ||
FR2 | 61..68 | CDD:409353 | 2/7 (29%) | ||
Ig strand C | 61..67 | CDD:409353 | 2/6 (33%) | ||
CDR2 | 69..79 | CDD:409353 | 4/9 (44%) | ||
Ig strand C' | 71..74 | CDD:409353 | 0/2 (0%) | ||
Ig strand C' | 76..79 | CDD:409353 | 1/2 (50%) | ||
FR3 | 80..115 | CDD:409353 | 7/34 (21%) | ||
Ig strand D | 84..91 | CDD:409353 | 1/6 (17%) | ||
Ig strand E | 94..100 | CDD:409353 | 1/5 (20%) | ||
Ig strand F | 107..115 | CDD:409353 | 3/7 (43%) | ||
CDR3 | 116..120 | CDD:409353 | 0/3 (0%) | ||
Ig strand G | 120..129 | CDD:409353 | 3/8 (38%) | ||
FR4 | 122..129 | CDD:409353 | 3/6 (50%) | ||
Ig strand A | 132..137 | CDD:409353 | 2/4 (50%) | ||
Ig_3 | 134..199 | CDD:404760 | 19/77 (25%) | ||
Ig strand A' | 140..145 | CDD:409353 | 1/4 (25%) | ||
Ig strand B | 148..157 | CDD:409353 | 1/8 (13%) | ||
Ig strand C | 163..167 | CDD:409353 | 2/3 (67%) | ||
Ig strand D | 174..177 | CDD:409353 | 0/2 (0%) | ||
Ig strand E | 178..183 | CDD:409353 | 1/4 (25%) | ||
Ig strand F | 191..199 | CDD:409353 | 3/7 (43%) | ||
Ig_3 | 217..295 | CDD:404760 | 27/94 (29%) | ||
putative Ig strand A | 218..224 | CDD:409353 | 2/5 (40%) | ||
Ig strand B | 234..238 | CDD:409353 | 2/3 (67%) | ||
Ig strand C | 247..251 | CDD:409353 | 0/3 (0%) | ||
Ig strand E | 274..278 | CDD:409353 | 2/3 (67%) | ||
Ig strand F | 288..293 | CDD:409353 | 2/4 (50%) | ||
Ig strand G | 301..304 | CDD:409353 | 1/2 (50%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |