DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dscam1 and wrk-1

DIOPT Version :9

Sequence 1:NP_001246162.1 Gene:Dscam1 / 35652 FlyBaseID:FBgn0033159 Length:2038 Species:Drosophila melanogaster
Sequence 2:NP_001024651.1 Gene:wrk-1 / 181093 WormBaseID:WBGene00006942 Length:452 Species:Caenorhabditis elegans


Alignment Length:345 Identity:82/345 - (23%)
Similarity:125/345 - (36%) Gaps:77/345 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   236 LVITEPVGSVSPQLSGNGNQEHITLTRVPKMG-SVTLMCPAQAYPVPFFRWYKFIEGTTRKQAVV 299
            |::...:.|.|.|:...|.      |.:.|.| |:||.|..:...|... |.|      ..:.|.
 Worm     7 LILGLLIASTSAQIRTKGG------TLIAKEGESLTLRCEVEDPSVAII-WRK------NTEVVA 58

  Fly   300 LNDRVKQVSG-----------TLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDP 353
            ::|.:....|           .|.||.....:|..|.|.:        .|..::||..:..::..
 Worm    59 VDDEILDTYGGYEISMEGSTSVLTIKRVEPINSANYSCAL--------AEPEVSVTFVIKVQVFK 115

  Fly   354 PTQ---------TVDFG--------RPAVFTCQY-TGNPIKTVSWMKDGKAI------GHSEPVL 394
            |||         :.|.|        :..|.||.. .|||...|.|.|....:      .|....:
 Worm   116 PTQVSVKPLVVISPDTGVYHARVGEKNLVITCHVKEGNPKPGVVWTKQAAKLPEDIKREHGGARI 180

  Fly   395 RIESVKKEDKGMYQCFVRNDQESAEASAELKL-----GGRFDPPVIRQAFQEETMEP---GPSVF 451
            .|..|||...|.|.|...|...|..|:.::.:     |.|.:.|.::   .|:|..|   ..:..
 Worm   181 VITEVKKHHAGKYNCLAENIAGSDRATIDIHVAEPLQGEREEKPWVK---NEDTFIPVRKNQNAS 242

  Fly   452 LKCVAGGNPTPEISWELDGKKIANNDR-----YQVGQYVTVNGDVVSYLNITSVHANDGGLYKCI 511
            ..|...|.|.|::.|..:|.||..||.     .:..|  .:||...|.|.:..:.....|.|.|.
 Worm   243 FWCTYDGTPVPQVEWLFNGYKINFNDEKFKKTSETAQ--RLNGYSKSTLTVGDISEEAFGDYACR 305

  Fly   512 AKSKVGVAEHSAKLNVYGLP 531
            ..:|:|..  :|.::|.|.|
 Worm   306 ISNKLGSV--TAVVHVSGRP 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dscam1NP_001246162.1 Ig 38..130 CDD:299845
IG 57..133 CDD:214652
IG_like 267..343 CDD:214653 18/87 (21%)
Ig 269..340 CDD:143165 16/81 (20%)
IG_like 353..425 CDD:214653 25/95 (26%)
IGc2 361..413 CDD:197706 18/66 (27%)
I-set 433..527 CDD:254352 25/101 (25%)
IGc2 446..517 CDD:197706 20/78 (26%)
I-set 533..618 CDD:254352
IGc2 544..607 CDD:197706
Ig 641..714 CDD:143165
IGc2 735..804 CDD:197706
I-set 819..914 CDD:254352
Ig 833..921 CDD:299845
FN3 918..1011 CDD:238020
FN3 1018..1116 CDD:238020
FN3 1124..1217 CDD:238020
FN3 1222..1312 CDD:238020
Ig 1339..1406 CDD:299845
FN3 1409..1499 CDD:238020
FN3 1504..1584 CDD:238020
Dscam_C 1890..2008 CDD:289151
wrk-1NP_001024651.1 IG_like 25..113 CDD:214653 22/108 (20%)
IGc2 31..96 CDD:197706 16/71 (23%)
IG_like 132..212 CDD:214653 21/79 (27%)
IGc2 142..202 CDD:197706 18/59 (31%)
IG_like 235..320 CDD:214653 21/88 (24%)
Ig 245..318 CDD:143165 21/76 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.