DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dscam1 and zig-4

DIOPT Version :9

Sequence 1:NP_001246162.1 Gene:Dscam1 / 35652 FlyBaseID:FBgn0033159 Length:2038 Species:Drosophila melanogaster
Sequence 2:NP_509335.1 Gene:zig-4 / 181051 WormBaseID:WBGene00006981 Length:253 Species:Caenorhabditis elegans


Alignment Length:187 Identity:53/187 - (28%)
Similarity:79/187 - (42%) Gaps:23/187 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   441 EETMEPGPSVF-LKCVAGGNPTPEISWELDGKKIANNDRYQV-------GQYVTVNGDVVSYLNI 497
            |..:.||...: |:|.....|...|.|:.:||.|..::...|       |:.:...|.|.|.|.|
 Worm    53 ESALIPGGETYQLRCDIMSTPAATIHWKFNGKLIQGSNELNVEEKLLNFGKAIVDTGIVASILTI 117

  Fly   498 TSVHANDGGLYKCIAKSKVGVAEHSAKLNVYG-LPYIRQMEKKA--IV---------AGETLIVT 550
            ....|.:.|.|.|:..:.....|..|::.:.| ....|...|.|  ||         .|....:.
 Worm   118 QCPSAENSGTYSCVGYNGHQTIETVAEVEI
EGEASGCRSNHKSAPEIVFWTDSRFEMTGNVATLV 182

  Fly   551 CPVAGYPIDSIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTCVAKNQEG 607
            |. |...:| .||..::..:..|.|..|..||.|:|:|:..: |..||||:|:||.|
 Worm   183 CR-ANQQVD-WVWMSNDELVKNNDKFTVLSNGDLVIKNIVWD-DMGTYTCIARNQFG 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dscam1NP_001246162.1 Ig 38..130 CDD:299845
IG 57..133 CDD:214652
IG_like 267..343 CDD:214653
Ig 269..340 CDD:143165
IG_like 353..425 CDD:214653
IGc2 361..413 CDD:197706
I-set 433..527 CDD:254352 24/93 (26%)
IGc2 446..517 CDD:197706 21/78 (27%)
I-set 533..618 CDD:254352 28/86 (33%)
IGc2 544..607 CDD:197706 22/62 (35%)
Ig 641..714 CDD:143165
IGc2 735..804 CDD:197706
I-set 819..914 CDD:254352
Ig 833..921 CDD:299845
FN3 918..1011 CDD:238020
FN3 1018..1116 CDD:238020
FN3 1124..1217 CDD:238020
FN3 1222..1312 CDD:238020
Ig 1339..1406 CDD:299845
FN3 1409..1499 CDD:238020
FN3 1504..1584 CDD:238020
Dscam_C 1890..2008 CDD:289151
zig-4NP_509335.1 I-set 47..147 CDD:254352 24/93 (26%)
Ig 65..144 CDD:143165 20/78 (26%)
IG_like 176..245 CDD:214653 23/64 (36%)
Ig <193..238 CDD:299845 18/45 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.