DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dscam1 and Dscam

DIOPT Version :10

Sequence 1:NP_001246162.1 Gene:Dscam1 / 35652 FlyBaseID:FBgn0033159 Length:2038 Species:Drosophila melanogaster
Sequence 2:XP_038943864.1 Gene:Dscam / 171119 RGDID:619992 Length:2034 Species:Rattus norvegicus


Alignment Length:1714 Identity:549/1714 - (32%)
Similarity:859/1714 - (50%) Gaps:88/1714 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 WLMLFAAVALIACGSQTLAANPPDADQKGPVFLKEPTNRIDFSNSTGAEIECKASGNPMPEIIWI 74
            |::   |::|....:...:..|    .....|:......:.|::::|..:.|.|:|.|...:.|.
  Rat     2 WIL---ALSLFQSFANVFSEEP----HSSLYFVNASLQEVVFASTSGTLVPCPAAGIPPVTLRWY 59

  Fly    75 RSDGTAVGDVPGLRQISSDGKLVFPPFRAEDYRQEVHAQVYACLARNQFGSIISRDVHVRAVVSQ 139
            .:.|..:.||||:|.:..:|.|...||....:...:|...|.|.|.|..|.|.|:|||::||:.:
  Rat    60 LATGEEIYDVPGIRHVHPNGTLQIFPFPPSSFSTLIHDNTYYCTAENPSGKIRSQDVHIKAVLRE 124

  Fly   140 HYEEDIHKAFVIRGNSAILKCDIPSFVADFVNVISWHSDEKENFYPGTEYDGKYLVLPSGELHIR 204
            .|...:.....:|||.|:.||.|||.|..:|.|:||..| ..:...|:    ::|:..:|.|:|:
  Rat   125 PYTVRVEDQKTMRGNVAVFKCIIPSSVEAYVTVVSWEKD-TVSLVSGS----RFLITSTGALYIK 184

  Fly   205 EVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVITEPVGSVSPQLSGNGNQEHITLTRVPKMGSV 269
            :|..|||..:|:|.|:||.|||||.| ...||.:::|..|....|.|..:::.:...|      |
  Rat   185 DVQNEDGLYNYRCITRHRYTGETRQS-NSARLFVSDPANSAPSILDGFDHRKAMAGQR------V 242

  Fly   270 TLMCPAQAYPVPFFRWYKFIEGTTRKQAVVLNDRVKQVSGTLIIKDAVVEDSGKYLCVVNNSVGG 334
            .|.|.|..:|.|.:||.|      ....:.|:.|.::....|:|:::...|||.|:|.|:|..|.
  Rat   243 ELPCKALGHPEPDYRWLK------DNMPLELSGRFQKTVTGLLIENSRPSDSGSYVCEVSNRYGT 301

  Fly   335 ESVETVLTVTAPLSAKIDPPTQTVDFGRPAVFTCQYTGNPIKTVSWMKDGKAIGHSEPV------ 393
            ..|...|.|..||.|.|.|.......|.....:|..|||..:.:||.::|:.:...:.|      
  Rat   302 AKVIGRLYVKQPLKATISPRKVKSSVGSQVSLSCSVTGNEDQELSWYRNGEILNPGKNVRITGLN 366

  Fly   394 ---LRIESVKKEDKGMYQCFVRNDQESAEASAELKLGGRFDPPVIRQAFQEETMEPGPSVFLKCV 455
               |.::.:.|.|.|.||||||.|:.||:...::.|  ....|.|..||.|:.:.|...|.|.|.
  Rat   367 HANLIMDHMVKSDGGAYQCFVRKDKLSAQDYVQVVL--EDGTPKIISAFSEKVVSPAEPVSLVCN 429

  Fly   456 AGGNPTPEISWELDGKKIANNDRYQVGQYVTVNGDVVSYLNITSVHANDGGLYKCIAKSKVGVAE 520
            ..|.|.|.::|.||...|.....:::.|.:|..|:|||||||:|....|||:|:|.|.:..||..
  Rat   430 VKGTPLPTVTWTLDDDPILKGSGHRISQMITSEGNVVSYLNISSSQVRDGGVYRCTANNSAGVVL 494

  Fly   521 HSAKLNVYGLPYIRQMEKKAIVAGETLIVTCPVAGYPIDSIVWERDNRALPINRKQKVFP-NGTL 584
            :.|::||.|...||.|:....:||....:.|.|.|||..||.|.::...||.|.:|..|. ||||
  Rat   495 YQARINVRGPASIRPMKNITAIAGRDTYIHCRVIGYPYYSIKWYKNANLLPFNHRQVAFENNGTL 559

  Fly   585 IIENVERNSDQATYTCVAKNQEGYSARGSLEVQVMVLPQIVPFAYEDLINMGDSIDLFCQIQKGD 649
            .:.:|::..|:..|||....|...|...|:.|.|.|.|.|.||.: ...::|..:.:.|.:..||
  Rat   560 KLSDVQKEVDEGEYTCNVLVQPQLSTSQSVHVTVKVPPFIQPFEF-PRFSIGQRVFIPCVVVSGD 623

  Fly   650 RPIKVHWS-----FERSAGDYGFDQVQPQMRTNRISEKTSMISIPSASPAHTGRDTCIASNKAGT 709
            .||.:.|.     ...|.| ...|.:          :.||.:.|.:.|..|.|..||||.|:|..
  Rat   624 LPITITWQKDGRPIPASLG-VTIDNI----------DFTSSLRISNLSLMHNGNYTCIARNEAAA 677

  Fly   710 TTYSVDLTVNVPPRWILEPTDKAFAQGSDAKVECKADGFPKPQVTWKKAVGDTPGEYKDLKKSDN 774
            ..:...|.|.|||:::::|.|:....|....:.|.|:|:|.|.:.||.:.|....:::.:..:..
  Rat   678 VEHQSQLIVRVPPKFVVQPRDQDGIYGKAVILNCSAEGYPVPTIVWKFSKGAGVPQFQPIALNGR 742

  Fly   775 IRV-EEGTLHVDNIQKTNEGYYLCEAINGIGSGLSAVIMISVQAPPEFTEKLRNQTARRGEPAVL 838
            |:| ..|:|.:.::.:.:.|||||:..|.:|:.:|..:.::|:.|...|.......|.:|:...:
  Rat   743 IQVLSNGSLLIKHVVEEDSGYYLCKVSNDVGADVSKSMYLTVKIPAMITSYPNTTLATQGQRKEM 807

  Fly   839 QCEAKGEKPIGILWNMNNMRLDPKNDNRYTIREEILSTGVMSSLSIKRTERSDSALFTCVATNAF 903
            .|.|.|||||.:.|...:..::|:. .||.:..:.:...|:|:|.|..|.|.||..|:|.|.|::
  Rat   808 SCTAHGEKPIIVRWEKEDRIINPEM-ARYLVSTKEVGEEVISTLQILPTVREDSGFFSCHAINSY 871

  Fly   904 GSDDASINMIVQEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPLDRYIIEFKRSRASWSEIDRV 968
            |.|...|.:.|||.|:.| .:::.|...|::.|.|...:|||||:..|.||.|....||....|.
  Rat   872 GEDRGIIQLTVQEPPDPP-EIEIKDVKARTITLRWTMGFDGNSPITGYDIECKNKSDSWDSAQRT 935

  Fly   969 -IVPGHTTEAQVQKLSPATTYNIRIVAENAIGTSQSSEAVTIITAEEAPSGKPQNIKVEPVNQTT 1032
             .|......|.:..:.|::||:||:.|:|.||.|:.|..:||...|.||.|.||.:.:||.:..:
  Rat   936 KDVSPQLNSATIIDIHPSSTYSIRMYAKNRIGKSEPSNEITITADEAAPDGPPQEVHLEPTSSQS 1000

  Fly  1033 MRVTWKPPPRTEWNGEILGYYVGYKLSNTNSSYVFETINFITEEGKEHNLELQNLRVYTQYSVVI 1097
            :|||||.|.:...||.|.||.:||:..:|..::.|..|: |...|......|.||..:|||.:|:
  Rat  1001 IRVTWKAPKKHLQNGIIRGYQIGYREYSTGGNFQFNIIS-IDTTGDSEVYTLDNLNKFTQYGLVV 1064

  Fly  1098 QAFNKIGAGPLSEEEKQFTAEGTPSQPPSDTACTTLTSQTIRVGWVSPPLESANGVIKTYKVVYA 1162
            ||.|:.|.||.|:|....|.|..||.||.:......:.::|.:.|.:...|:.||:::.::|:|.
  Rat  1065 QACNRAGTGPSSQEIITTTLEDVPSYPPENVQAIATSPESISISWSTLSKEALNGILQGFRVIYW 1129

  Fly  1163 PS--DEWYDETKRHYKKTASSDTVLHGLKKYTNYTMQVLATTAGGDGVRSVPIHCQTEPDVPEAP 1225
            .:  |....|.|.  ..|......|.||:|||||::||||.|..||||||..|..:|:.|||..|
  Rat  1130 ANLIDGELGEIKN--VTTTQPSLELDGLEKYTNYSIQVLAFTRAGDGVRSEQIFTRTKEDVPGPP 1192

  Fly  1226 TDVKALVMGNAAILVSWRPPAQPNGIITQYTVYSKAEGAETETKTQKVPHYQMSFEATELEKNKP 1290
            ..|||.....:.:.|||.||.:.||||.:|||:.........::.:..|. ..|:....|.:|:.
  Rat  1193 AGVKAAAASASMVFVSWLPPLKLNGIIRKYTVFCSHPYPTVISEFEASPD-SFSYRIPNLSRNRQ 1256

  Fly  1291 YEFWVTASTTIGEGQQSKSIVAMPSDQVPAKIASFDDTFTATFKEDAKMPCLAVGAPQPEITW-- 1353
            |..||.|.|:.|.|..|:.|...|..:.||:|.:|..|.|..:.:|..:||.|||.|.|.:.|  
  Rat  1257 YSVWVVAVTSAGRGNSSEIITVEPLAKAPARILTFSGTVTTPWMKDIVLPCKAVGDPSPAVKWMK 1321

  Fly  1354 KIKGVE--FSANDRMRVLPDGSLLIKSVNRQDAGDYSCHAENSIAKDSITHKLIVLAPPQSPHVT 1416
            ...|..  .:.:.|..:..:||.:|::|..:|:|.|||.|.|:...|.|...|.|..||..|.:|
  Rat  1322 DSNGTPSLVTIDGRRSIFSNGSFVIRTVKAEDSGYYSCVANNNWGSDEIILNLQVQVPPDQPRLT 1386

  Fly  1417 LSATTTDALTVKLKPHEGDTAPLHGYTLHYKPEFGE-WETSEVSVDSQKHNIEGLLCGSRYQVYA 1480
            :|.||:.::|:...|.:...:.:.||.|.|..:..| |.:..:|...:.:.:|.|.||:.|:...
  Rat  1387 VSKTTSSSITLSWLPGDNGGSSIRGYILQYSEDNSEQWGSFPISPSERSYRLENLKCGTWYKFTL 1451

  Fly  1481 TGFNNIGAGEASDILNTRTKGQKPKL-PEKPRFIEVSSNSVSLHFKAWKDGGCPMSHFVVESKKR 1544
            |..|.:|.|..|:|:..:|.|::|:. .|:..|..:::..|.|:...|.|||||::.|.:|.:..
  Rat  1452 TAQNGVGPGRISEIIEAKTLGKEPQFSKEQELFASINTTRVRLNLIGWNDGGCPITSFTLEYRPF 1516

  Fly  1545 DQIEWNQISNNVKPDNNYVVLDLEPATWYNLRITAHNSAGFTVAEYDFATLTVTGGTIAPLDDGS 1609
            ....|. .:.......:|::.||:.||||.|::...||||....:.:||||...|.||.||    
  Rat  1517 GTTVWT-TAQRTSLSKSYILYDLQEATWYELQMRVCNSAGCAEKQANFATLNYDGSTIPPL---- 1576

  Fly  1610 GHGNVHTRIRLPAWMPEWLDLNFMVPLIATVVVVAVGICVVCVAL---SRRRADDMRGGQKDV-- 1669
                    |:......|.|..|..:.::.|:..:.||:.::.|.|   .|||.:......:|.  
  Rat  1577 --------IKSVVQSEEGLTTNEGLKILVTISCILVGVLLLFVLLLVVRRRRREQRLKRLRDAKS 1633

  Fly  1670 YYDVVYNQTMGPGATLDKRRPDLR 1693
            ..:::.::......||.|::..||
  Rat  1634 LAEMLMSKNTRTSDTLSKQQQTLR 1657

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dscam1NP_001246162.1 IgI_1_Dscam 38..136 CDD:409547 29/97 (30%)
Ig strand A 39..42 CDD:409547 0/2 (0%)
Ig strand A' 48..52 CDD:409547 0/3 (0%)
Ig strand B 55..64 CDD:409547 2/8 (25%)
Ig strand C 70..76 CDD:409547 1/5 (20%)
Ig strand C' 78..81 CDD:409547 1/2 (50%)
Ig strand D 87..90 CDD:409547 1/2 (50%)
Ig strand E 95..100 CDD:409547 1/4 (25%)
Ig strand F 113..121 CDD:409547 3/7 (43%)
Ig strand G 124..136 CDD:409547 6/11 (55%)
IgI_2_Dscam 246..343 CDD:409545 26/96 (27%)
Ig strand A 247..250 CDD:409545 0/2 (0%)
Ig strand A' 260..264 CDD:409545 1/3 (33%)
Ig strand B 267..274 CDD:409545 2/6 (33%)
Ig strand C 282..288 CDD:409545 2/5 (40%)
Ig strand C' 294..297 CDD:409545 0/2 (0%)
Ig strand D 303..307 CDD:409545 1/3 (33%)
Ig strand E 309..315 CDD:409545 2/5 (40%)
Ig strand F 322..330 CDD:409545 4/7 (57%)
Ig strand G 333..343 CDD:409545 3/9 (33%)
IgC2_3_Dscam 346..426 CDD:409549 27/88 (31%)
Ig strand A 347..352 CDD:409549 2/4 (50%)
Ig strand A' 355..359 CDD:409549 0/3 (0%)
Ig strand B 362..372 CDD:409549 1/9 (11%)
Ig strand C 377..383 CDD:409549 2/5 (40%)
Ig strand C' 384..387 CDD:409549 1/2 (50%)
Ig strand E 392..398 CDD:409549 2/14 (14%)
Ig strand F 405..413 CDD:409549 6/7 (86%)
Ig strand G 416..426 CDD:409549 2/9 (22%)
IgI_4_Dscam 432..527 CDD:409548 36/94 (38%)
Ig strand A 432..435 CDD:409548 1/2 (50%)
Ig strand A' 441..445 CDD:409548 1/3 (33%)
Ig strand B 448..457 CDD:409548 3/8 (38%)
Ig strand C 462..468 CDD:409548 2/5 (40%)
Ig strand C' 470..473 CDD:409548 0/2 (0%)
Ig strand D 478..486 CDD:409548 1/7 (14%)
Ig strand E 490..499 CDD:409548 7/8 (88%)
Ig strand F 506..514 CDD:409548 4/7 (57%)
Ig strand G 517..527 CDD:409548 3/9 (33%)
IgI_5_Dscam 531..618 CDD:409550 31/87 (36%)
Ig strand A 531..533 CDD:409550 0/1 (0%)
Ig strand A' 538..542 CDD:409550 0/3 (0%)
Ig strand B 545..552 CDD:409550 0/6 (0%)
Ig strand C 559..565 CDD:409550 3/5 (60%)
Ig strand C' 566..568 CDD:409550 0/1 (0%)
Ig strand D 575..579 CDD:409550 1/3 (33%)
Ig strand E 582..588 CDD:409550 3/5 (60%)
Ig strand F 596..604 CDD:409550 3/7 (43%)
Ig strand G 608..618 CDD:409550 3/9 (33%)
Ig 621..718 CDD:472250 27/101 (27%)
Ig strand B 639..643 CDD:409353 0/3 (0%)
Ig strand C 653..657 CDD:409353 0/3 (0%)
Ig strand E 684..688 CDD:409353 1/3 (33%)
Ig strand F 698..703 CDD:409353 2/4 (50%)
Ig strand G 711..714 CDD:409353 0/2 (0%)
IgI_7_Dscam 721..815 CDD:409546 25/94 (27%)
Ig strand A 721..725 CDD:409546 2/3 (67%)
Ig strand A' 730..734 CDD:409546 1/3 (33%)
Ig strand B 737..746 CDD:409546 1/8 (13%)
Ig strand C 752..758 CDD:409546 2/5 (40%)
Ig strand C' 764..767 CDD:409546 0/2 (0%)
Ig strand D 775..778 CDD:409546 2/3 (67%)
Ig strand E 780..786 CDD:409546 2/5 (40%)
Ig strand F 793..801 CDD:409546 5/7 (71%)
Ig strand G 806..815 CDD:409546 1/8 (13%)
Ig 818..916 CDD:472250 31/97 (32%)
Ig strand B 836..840 CDD:409353 0/3 (0%)
Ig strand C 849..853 CDD:409353 0/3 (0%)
Ig strand E 880..884 CDD:409353 2/3 (67%)
Ig strand F 894..899 CDD:409353 2/4 (50%)
FN3 <899..1212 CDD:442628 118/315 (37%)
Ig strand G 907..910 CDD:409353 0/2 (0%)
FN3 1222..1312 CDD:238020 30/89 (34%)
Ig <1339..1406 CDD:472250 24/70 (34%)
Ig strand C 1350..1354 CDD:409358 1/5 (20%)
Ig strand E 1372..1376 CDD:409358 2/3 (67%)
Ig strand F 1386..1391 CDD:409358 3/4 (75%)
Ig strand G 1399..1402 CDD:409358 1/2 (50%)
FN3 1409..1499 CDD:238020 27/90 (30%)
FN3 1504..1584 CDD:238020 24/80 (30%)
Dscam_C 1893..2008 CDD:463546
DscamXP_038943864.1 Ig 26..121 CDD:472250 29/94 (31%)
Ig strand B 42..46 CDD:409547 0/3 (0%)
Ig strand C 55..59 CDD:409547 0/3 (0%)
Ig strand E 79..83 CDD:409547 2/3 (67%)
Ig strand F 99..104 CDD:409547 2/4 (50%)
Ig strand G 112..116 CDD:409547 1/3 (33%)
Ig 125..210 CDD:472250 35/89 (39%)
Ig strand B 141..145 CDD:409353 1/3 (33%)
Ig strand C 157..161 CDD:409353 2/3 (67%)
Ig strand E 179..183 CDD:409353 2/3 (67%)
Ig strand F 192..199 CDD:409353 2/6 (33%)
Ig 235..310 CDD:472250 24/86 (28%)
Ig strand B 242..246 CDD:409353 2/3 (67%)
Ig strand C 255..259 CDD:409353 1/3 (33%)
Ig strand F 290..295 CDD:409353 2/4 (50%)
Ig 313..395 CDD:472250 26/81 (32%)
Ig strand B 331..335 CDD:409353 0/3 (0%)
Ig strand C 344..348 CDD:409353 1/3 (33%)
Ig strand E 368..372 CDD:409353 1/3 (33%)
Ig strand F 382..387 CDD:409353 3/4 (75%)
Ig 406..501 CDD:472250 36/94 (38%)
Ig strand B 424..428 CDD:409353 2/3 (67%)
Ig strand C 437..441 CDD:409353 0/3 (0%)
Ig strand E 467..471 CDD:409353 3/3 (100%)
Ig strand F 481..486 CDD:409353 2/4 (50%)
Ig strand G 494..497 CDD:409353 0/2 (0%)
Ig 504..593 CDD:472250 31/88 (35%)
Ig strand B 521..525 CDD:409353 0/3 (0%)
Ig strand C 534..538 CDD:409353 2/3 (67%)
Ig strand E 557..561 CDD:409353 3/3 (100%)
Ig strand F 572..577 CDD:409353 3/4 (75%)
Ig strand G 586..589 CDD:409353 0/2 (0%)
Ig 596..686 CDD:472250 27/101 (27%)
Ig strand B 613..617 CDD:409353 0/3 (0%)
Ig strand C 627..631 CDD:409353 0/3 (0%)
Ig strand E 652..656 CDD:409353 1/3 (33%)
Ig strand F 666..671 CDD:409353 2/4 (50%)
Ig strand G 679..682 CDD:409353 0/2 (0%)
Ig_DSCAM 689..784 CDD:409397 25/94 (27%)
putative Ig strand A 689..693 CDD:409397 2/3 (67%)
putative Ig strand A' 698..702 CDD:409397 1/3 (33%)
putative Ig strand B 704..714 CDD:409397 2/9 (22%)
putative Ig strand C 720..726 CDD:409397 2/5 (40%)
putative Ig strand C' 733..736 CDD:409397 0/2 (0%)
putative Ig strand D 744..747 CDD:409397 1/2 (50%)
putative Ig strand E 749..755 CDD:409397 2/5 (40%)
putative Ig strand F 762..770 CDD:409397 5/7 (71%)
putative Ig strand G 775..784 CDD:409397 1/8 (13%)
Ig_DSCAM 785..884 CDD:409398 31/99 (31%)
putative Ig strand A 785..788 CDD:409398 0/2 (0%)
putative Ig strand A' 796..800 CDD:409398 0/3 (0%)
putative Ig strand B 803..810 CDD:409398 0/6 (0%)
putative Ig strand C 818..824 CDD:409398 1/5 (20%)
putative Ig strand C' 833..836 CDD:409398 1/2 (50%)
putative Ig strand D 842..846 CDD:409398 0/3 (0%)
putative Ig strand E 848..854 CDD:409398 3/5 (60%)
putative Ig strand F 861..869 CDD:409398 3/7 (43%)
putative Ig strand G 872..882 CDD:409398 3/9 (33%)
FN3 885..978 CDD:238020 32/93 (34%)
FN3 <937..1300 CDD:442628 133/366 (36%)
Ig_3 1287..1363 CDD:464046 25/75 (33%)
FN3 1380..1470 CDD:238020 26/89 (29%)
FN3 1486..1555 CDD:238020 21/69 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.