DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dscam1 and VSIG10L

DIOPT Version :10

Sequence 1:NP_001246162.1 Gene:Dscam1 / 35652 FlyBaseID:FBgn0033159 Length:2038 Species:Drosophila melanogaster
Sequence 2:XP_054175822.1 Gene:VSIG10L / 147645 HGNCID:27111 Length:881 Species:Homo sapiens


Alignment Length:789 Identity:167/789 - (21%)
Similarity:272/789 - (34%) Gaps:216/789 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   332 VGGE-SVETVLTVTAPLSAKIDPPTQTVDFGRPAVFTCQYTGNPIKTVSWMKDGK-----AIGHS 390
            |||. :|....|:..||....:|                  |.|...|.|.:..|     .:|..
Human   195 VGGPLAVLVGTTIRLPLVPIPNP------------------GPPTSLVVWRRGSKVLAAGGLGPG 241

  Fly   391 EPVLRIESVKKEDKGMYQCFVRNDQESAE---ASAELKLGGRFDPPVIRQAFQEET-------ME 445
            .|::.::...::       .:|.||....   |||:|...|.:...|||....::|       .|
Human   242 APLISLDPAHRD-------HLRFDQARGVLELASAQLDDAGVYTAEVIRAGVSQQTHEFTVGVYE 299

  Fly   446 PGPSVF----------------LKCVAGGNPTPEISWELDGKKI--ANNDRYQVGQYVTVNGDVV 492
            |.|.:.                |:|:..|....|:||..||:.:  |.::..:..:..:....::
Human   300 PLPQLSVQPKAPETEEGAAELRLRCLGWGPGRGELSWSRDGRALEAAESEGAETPRMRSEGDQLL 364

  Fly   493 SYLNITSVHANDGGLYKCIAKSKVGVAEHSAKLNV-YG--LPYIR-QMEKKA-----IVAGETLI 548
            ....:.|.||.    |.|..:|..|..|.:|.::| ||  .|.|. ..::.|     :.||..:.
Human   365 IVRPVRSDHAR----YTCRVRSPFGHREAAADVSVFYGPDPPTITVSSDRDAAPARFVTAGSNVT 425

  Fly   549 VTCPVAGYPIDSIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTCVAKN-QEGYSARG 612
            :.|..|..|...|.|...:.|      :...|.|:.::..........||.|:|.| :.|...|.
Human   426 LRCAAASRPPADITWSLADPA------EAAVPAGSRLLLPAVGPGHAGTYACLAANPRTGRRRRS 484

  Fly   613 SLEVQVMVLPQIVPFAYEDLINMGDSIDLFCQIQ--KGDRPIKVH--WSFERSAGDYGFDQVQPQ 673
            .|.:.|..||...|               .|.::  .|||.::..  |.....|....|..:...
Human   485 LLNLTVADLPPGAP---------------QCSVEGGPGDRSLRFRCSWPGGAPAASLQFQGLPEG 534

  Fly   674 MRTNRISEKTSMISIPSASPAHTGRD----TCIASNKAGTTTYSVDLTVNVPPRWILEPTDKAFA 734
            :|...:|.     .:.:|.|||....    ||:|.:...|.|.:|  |...|...:|.|. .|..
Human   535 IRAGPVSS-----VLLAAVPAHPRLSGVPITCLARHLVATRTCTV--TPEAPREVLLHPL-VAET 591

  Fly   735 QGSDAKVECKADGFPKP-QVTW-KKAVGDTPGEYKDLKKSDNIRVEEGTLHVDNIQ-KTNEGYY- 795
            :..:|:|..:|.|.|.| :.:| ::.....||....|:.|.:.|    .||:.|.. ..:.|.| 
Human   592 RLGEAEVALEASGCPPPSRASWAREGRPLAPGGGSRLRLSQDGR----KLHIGNFSLDWDLGNYS 652

  Fly   796 -LCEAINGIGSGLSAVIMISVQAPPEFTEKLRNQTARRGEPAVL-------------QCEAKGEK 846
             ||....|.|.....:|..|:.:       .|.|.||  :.|||             :.:|..:.
Human   653 VLCSGALGAGGDQITLIGPSISS-------WRLQRAR--DAAVLTWDVERGALISSFEIQAWPDG 708

  Fly   847 PIGILWNMNNMR------------------LDPKNDNRYTIREEILSTGVMSSLSIKRTER---- 889
            |  .|...:..|                  |.|:|...:|.|...:..|...:.|..|..|    
Human   709 P--ALGRTSTYRDWVSLLILGPQERSAVVPLPPRNPGTWTFRILPILGGQPGTPSQSRVYRAGPT 771

  Fly   890 -SDSALFTCVATNAFGSDDASINMIV---------QEVPEM---PYAL-KVLDKSGRS------V 934
             |..|:...|..:..|....::.:::         .:.||.   |..| .|:..|.:.      |
Human   772 LSHGAIAGIVLGSLLGLALLAVLLLLCICCLCRFRGKTPEKKKHPSTLVPVVTPSEKKMHSVTPV 836

  Fly   935 QLSWAQPYDGNSPLDRYIIEFKRSRASWSEIDRVIVPGHTTEAQVQKLSPATTYNIRIVAENAIG 999
            ::||  |.|...||:                      .|::....|...|::..::.       |
Human   837 EISW--PLDLKVPLE----------------------DHSSTRAYQATDPSSVVSVG-------G 870

  Fly  1000 TSQSSEAVT 1008
            .|::..|.|
Human   871 GSKTVRAAT 879

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dscam1NP_001246162.1 IgI_1_Dscam 38..136 CDD:409547
Ig strand A 39..42 CDD:409547
Ig strand A' 48..52 CDD:409547
Ig strand B 55..64 CDD:409547
Ig strand C 70..76 CDD:409547
Ig strand C' 78..81 CDD:409547
Ig strand D 87..90 CDD:409547
Ig strand E 95..100 CDD:409547
Ig strand F 113..121 CDD:409547
Ig strand G 124..136 CDD:409547
IgI_2_Dscam 246..343 CDD:409545 4/11 (36%)
Ig strand A 247..250 CDD:409545
Ig strand A' 260..264 CDD:409545
Ig strand B 267..274 CDD:409545
Ig strand C 282..288 CDD:409545
Ig strand C' 294..297 CDD:409545
Ig strand D 303..307 CDD:409545
Ig strand E 309..315 CDD:409545
Ig strand F 322..330 CDD:409545
Ig strand G 333..343 CDD:409545 3/10 (30%)
IgC2_3_Dscam 346..426 CDD:409549 17/87 (20%)
Ig strand A 347..352 CDD:409549 1/4 (25%)
Ig strand A' 355..359 CDD:409549 0/3 (0%)
Ig strand B 362..372 CDD:409549 0/9 (0%)
Ig strand C 377..383 CDD:409549 2/5 (40%)
Ig strand C' 384..387 CDD:409549 1/7 (14%)
Ig strand E 392..398 CDD:409549 1/5 (20%)
Ig strand F 405..413 CDD:409549 0/7 (0%)
Ig strand G 416..426 CDD:409549 4/12 (33%)
IgI_4_Dscam 432..527 CDD:409548 25/119 (21%)
Ig strand A 432..435 CDD:409548 0/2 (0%)
Ig strand A' 441..445 CDD:409548 1/10 (10%)
Ig strand B 448..457 CDD:409548 3/24 (13%)
Ig strand C 462..468 CDD:409548 3/5 (60%)
Ig strand C' 470..473 CDD:409548 1/2 (50%)
Ig strand D 478..486 CDD:409548 0/7 (0%)
Ig strand E 490..499 CDD:409548 0/8 (0%)
Ig strand F 506..514 CDD:409548 2/7 (29%)
Ig strand G 517..527 CDD:409548 3/9 (33%)
IgI_5_Dscam 531..618 CDD:409550 21/93 (23%)
Ig strand A 531..533 CDD:409550 1/1 (100%)
Ig strand A' 538..542 CDD:409550 1/8 (13%)
Ig strand B 545..552 CDD:409550 0/6 (0%)
Ig strand C 559..565 CDD:409550 2/5 (40%)
Ig strand C' 566..568 CDD:409550 0/1 (0%)
Ig strand D 575..579 CDD:409550 0/3 (0%)
Ig strand E 582..588 CDD:409550 1/5 (20%)
Ig strand F 596..604 CDD:409550 4/7 (57%)
Ig strand G 608..618 CDD:409550 2/9 (22%)
Ig 621..718 CDD:472250 22/104 (21%)
Ig strand B 639..643 CDD:409353 0/3 (0%)
Ig strand C 653..657 CDD:409353 0/5 (0%)
Ig strand E 684..688 CDD:409353 0/3 (0%)
Ig strand F 698..703 CDD:409353 2/8 (25%)
Ig strand G 711..714 CDD:409353 1/2 (50%)
IgI_7_Dscam 721..815 CDD:409546 26/98 (27%)
Ig strand A 721..725 CDD:409546 1/3 (33%)
Ig strand A' 730..734 CDD:409546 1/3 (33%)
Ig strand B 737..746 CDD:409546 2/8 (25%)
Ig strand C 752..758 CDD:409546 1/6 (17%)
Ig strand C' 764..767 CDD:409546 1/2 (50%)
Ig strand D 775..778 CDD:409546 1/2 (50%)
Ig strand E 780..786 CDD:409546 2/5 (40%)
Ig strand F 793..801 CDD:409546 4/9 (44%)
Ig strand G 806..815 CDD:409546 1/8 (13%)
Ig 818..916 CDD:472250 24/142 (17%)
Ig strand B 836..840 CDD:409353 3/16 (19%)
Ig strand C 849..853 CDD:409353 1/3 (33%)
Ig strand E 880..884 CDD:409353 0/3 (0%)
Ig strand F 894..899 CDD:409353 0/4 (0%)
FN3 <899..1212 CDD:442628 21/129 (16%)
Ig strand G 907..910 CDD:409353 0/2 (0%)
FN3 1222..1312 CDD:238020
Ig <1339..1406 CDD:472250
Ig strand C 1350..1354 CDD:409358
Ig strand E 1372..1376 CDD:409358
Ig strand F 1386..1391 CDD:409358
Ig strand G 1399..1402 CDD:409358
FN3 1409..1499 CDD:238020
FN3 1504..1584 CDD:238020
Dscam_C 1893..2008 CDD:463546
VSIG10LXP_054175822.1 Ig_3 302..381 CDD:464046 15/82 (18%)
Ig_3 401..475 CDD:464046 17/79 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.