DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dscam1 and IL31RA

DIOPT Version :9

Sequence 1:NP_001246162.1 Gene:Dscam1 / 35652 FlyBaseID:FBgn0033159 Length:2038 Species:Drosophila melanogaster
Sequence 2:NP_620586.3 Gene:IL31RA / 133396 HGNCID:18969 Length:764 Species:Homo sapiens


Alignment Length:562 Identity:117/562 - (20%)
Similarity:200/562 - (35%) Gaps:162/562 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   834 EPAVLQCEAKGEKPIGILWNMNNMRLDPKNDNRYTIREEILSTGVMSSLSIKRT----ERSDSAL 894
            :|..:.|.....|.:...|:       |..:..||            ..::|||    |:.|:  
Human    56 KPENISCVYYYRKNLTCTWS-------PGKETSYT------------QYTVKRTYAFGEKHDN-- 99

  Fly   895 FTCVATNAFGSDDASINMIVQE--VPEMPYALKVLDKSG-------------------------- 931
              |...::...:.||.:..:..  :|: .|.::|..::|                          
Human   100 --CTTNSSTSENRASCSFFLPRITIPD-NYTIEVEAENGDGVIKSHMTYWRLENIAKTEPPKIFR 161

  Fly   932 --------RSVQLSWAQPYDGNSPLD-RYIIEFKR-SRASWSEIDRVIVPGHTTEAQVQKLS--- 983
                    |.:|:.|.:|.......| :|.:.|:. :..||.|::  .......:.|...|:   
Human   162 VKPVLGIKRMIQIEWIKPELAPVSSDLKYTLRFRTVNSTSWMEVN--FAKNRKDKNQTYNLTGLQ 224

  Fly   984 PATTYNIRI---VAENAIGTSQSSEAVTIITAEEAPSG-------KPQNIKVEPVNQTTMRVTWK 1038
            |.|.|.|.:   |.|:...:..|.|.:. :|.||||.|       ||    .|...:..:|:.||
Human   225 PFTEYVIALRCAVKESKFWSDWSQEKMG-MTEEEAPCGLELWRVLKP----AEADGRRPVRLLWK 284

  Fly  1039 PPPRTEWNGEILGYYVG-YKLSNTNSSYVFETINFITEEGKEHNLELQNLRVY---TQYSVVIQA 1099
            .........:.|||.:. |..||||.:....|.|             |.|.::   ..:.|.:.:
Human   285 KARGAPVLEKTLGYNIWYYPESNTNLTETMNTTN-------------QQLELHLGGESFWVSMIS 336

  Fly  1100 FNKIGAGPLSE------EEKQFTAEGTPSQPPSDTACTTLTSQTIRVGWVSPPLESANGVIKTYK 1158
            :|.:|..|::.      :||.|.......      ||  :....:.|.|.|..|:     :.|:.
Human   337 YNSLGKSPVATLRIPAIQEKSFQCIEVMQ------AC--VAEDQLVVKWQSSALD-----VNTWM 388

  Fly  1159 VVYAPSDEWYDETKRHYKKTASSDTVL--HGLKKYTNYTMQ----------------VLATTAGG 1205
            :      ||:.:..       |..|.|  ..:.:.||:|:|                :|....| 
Human   389 I------EWFPDVD-------SEPTTLSWESVSQATNWTIQQDKLKPFWCYNISVYPMLHDKVG- 439

  Fly  1206 DGVRSVPIHCQTEPDVPEAPTDVKALVMGNAAILVSWR--PPAQPNGIITQYTVYSKAEGAETET 1268
               ....|....:..||....:.|...:|...:.::|:  |.::..|||..||::.:|||.:..:
Human   440 ---EPYSIQAYAKEGVPSEGPETKVENIGVKTVTITWKEIPKSERKGIICNYTIFYQAEGGKGFS 501

  Fly  1269 KTQKVPHYQMSFEATELEKNKPYEFWVTASTTIGEGQQSKSI 1310
            ||......|...|:  |::...|...|.|||:.| |....||
Human   502 KTVNSSILQYGLES--LKRKTSYIVQVMASTSAG-GTNGTSI 540

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dscam1NP_001246162.1 Ig 38..130 CDD:299845
IG 57..133 CDD:214652
IG_like 267..343 CDD:214653
Ig 269..340 CDD:143165
IG_like 353..425 CDD:214653
IGc2 361..413 CDD:197706
I-set 433..527 CDD:254352
IGc2 446..517 CDD:197706
I-set 533..618 CDD:254352
IGc2 544..607 CDD:197706
Ig 641..714 CDD:143165
IGc2 735..804 CDD:197706
I-set 819..914 CDD:254352 15/83 (18%)
Ig 833..921 CDD:299845 16/92 (17%)
FN3 918..1011 CDD:238020 24/134 (18%)
FN3 1018..1116 CDD:238020 25/114 (22%)
FN3 1124..1217 CDD:238020 19/110 (17%)
FN3 1222..1312 CDD:238020 27/91 (30%)
Ig 1339..1406 CDD:299845
FN3 1409..1499 CDD:238020
FN3 1504..1584 CDD:238020
Dscam_C 1890..2008 CDD:289151
IL31RANP_620586.3 FN3 57..151 CDD:304408 19/117 (16%)
FN3 155..254 CDD:238020 20/101 (20%)
FN3 453..533 CDD:214495 23/81 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.