DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dscam1 and ncam2

DIOPT Version :10

Sequence 1:NP_001246162.1 Gene:Dscam1 / 35652 FlyBaseID:FBgn0033159 Length:2038 Species:Drosophila melanogaster
Sequence 2:NP_571905.1 Gene:ncam2 / 114441 ZFINID:ZDB-GENE-010822-1 Length:795 Species:Danio rerio


Alignment Length:752 Identity:172/752 - (22%)
Similarity:302/752 - (40%) Gaps:135/752 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   409 CF----VRNDQESAEASAELKLGGRFDPPVIRQAFQEETMEPGPSVFLKCVAGGNPTPEISW-EL 468
            ||    |...|.:.:.|..||               :..:..|.|.|..|...|.|. ::.| ..
Zfish     7 CFLGLLVGGSQGALQVSISLK---------------KVELSVGESKFFTCTVIGEPV-KLEWFNP 55

  Fly   469 DGKKIANNDRYQVGQYVTVNGDVVSYLNITSVHANDGGLYKCIAKSKVG-VAEHSAKLNVYGLPY 532
            .|:::..:.|..:.     |..:.|.|.:.:....|.|:|:|.|....| ..|.:..|.:|....
Zfish    56 QGERMVASPRVALH-----NEGIRSRLTLYNAKIEDAGIYRCQATDAQGETQEATVVLEIYQKLT 115

  Fly   533 IRQMEK-KAIVAGETLIVTCPVAGYPIDSIVWERDNRALPIN-RKQKVFPNGTLIIENVERNSDQ 595
            .|.:.. :....||...|.|.|...|:..:.|..:|..:..: .|.::..|..|.::.|.: :|:
Zfish   116 FRDVRSPQEFRQGEVAEVVCDVTSSPVPVVSWFYNNIEITEDTEKFELLQNNNLQVQKVTK-ADE 179

  Fly   596 ATYTCVAKNQEGYSARGSLEVQVMVL----PQIVPF---AYEDLINMGDSIDLFCQIQKGDRPIK 653
            ..|.|.|:    ..|||.::.:.::|    |.:|..   ::....:.|:|:...|:......| .
Zfish   180 GVYRCEAR----VEARGEIDFRNIILVVNVPPVVSVPQQSFNATADYGESVTFTCRAYGSPEP-D 239

  Fly   654 VHWSFERSAGDYGFDQVQPQMRTNRISEKTSMISIPSASPAHTGRDTCIASNKAGTTTYSVDLTV 718
            |.|..:..       |:|...|....:..|: :::.:......|..||.||||||...:.:.|.|
Zfish   240 VTWHRKGV-------QLQESERYVMRARGTT-LTVRNIQQDDGGSYTCRASNKAGEVEHELFLKV 296

  Fly   719 NVPPRWILEPTDKAFAQGSDAKVECKADGFPKPQVTWKKAVGDTPG-EYKDLKKSDNIRVE---- 778
            .|.|. |.:..:....:||.|.:.|||:|.|.|:::|::|   :.| .:.|..||.:.|||    
Zfish   297 FVQPH-ITKLRNVTAVEGSAAMISCKAEGEPLPEISWRRA---SDGHSFSDGDKSPDGRVEVRGR 357

  Fly   779 --EGTLHVDNIQKTNEGYYLCEAINGIGSGLSAVIMISVQAPPEFTEKLRNQT---ARRGEPAVL 838
              |..|.:..::.::.|.:.|||::.|| |....:.:.::..|:|.   .|.|   :..|.|..:
Zfish   358 YGESMLTIVVVKLSDWGRFDCEALSRIG-GHQKSMFLDIEYAPKFQ---ANHTIFFSWEGNPVNI 418

  Fly   839 QCEAKGEKPIGILWNMNNMRLDPK---NDNRYTIREEILSTGVMSSLSIKRTERSDSALFTCVAT 900
            .|:.....|..:||....:.:..:   |...||      :.| .|.|.:......|...:.|.|.
Zfish   419 SCDVMSNPPATMLWRREKLTIPSEGAGNMRVYT------APG-RSLLEVTPMSDRDFGRYNCTAR 476

  Fly   901 NAFGSDDASINMIVQEVPEMPYALKVLDKSGRSVQLSWAQP-YDGNSPLDRYIIEFKR-SRASWS 963
            |..|.......:...:||..||::::...:.|...:::.:| ..|..|:..|::::|. |...|.
Zfish   477 NNIGMRFQEFILAQADVPSNPYSVRLSSVAQRVATVTFTKPDSHGGVPISHYLVKYKDISSQDWK 541

  Fly   964 EIDRVIVPGHTTEAQVQKLSPATTYNIRIVAENAIGTSQSSEAVTIITAEEAPSGKPQNIKVEPV 1028
            ::..:   |..|...:..|.|.|||.:|:.|.|..|..:.|..              ::.:..|:
Zfish   542 DVKSL---GTQTIVLLTNLEPNTTYEVRVSAVNGKGQGEFSHT--------------ESFQTLPI 589

  Fly  1029 NQTTMRVTWKPPPRTEWNGE--------------------ILGYYVGYKLSNTNSSYVFETINFI 1073
            .:.:       ||..:  |:                    ||.|.|.|| ::....::.:.:   
Zfish   590 REPS-------PPSVQ--GQRGVGKAYRLGLVKQDDGGMPILEYIVKYK-TDKEEQWMTKLV--- 641

  Fly  1074 TEEGKEHNLELQNLRVYTQYSVVIQAFNKIGAGPLSE 1110
              .|....:.||.|:..|||.|.|.|.|..|   |||
Zfish   642 --PGVNDFVLLQPLQWNTQYEVEITARNVKG---LSE 673

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dscam1NP_001246162.1 IgI_1_Dscam 38..136 CDD:409547
Ig strand A 39..42 CDD:409547
Ig strand A' 48..52 CDD:409547
Ig strand B 55..64 CDD:409547
Ig strand C 70..76 CDD:409547
Ig strand C' 78..81 CDD:409547
Ig strand D 87..90 CDD:409547
Ig strand E 95..100 CDD:409547
Ig strand F 113..121 CDD:409547
Ig strand G 124..136 CDD:409547
IgI_2_Dscam 246..343 CDD:409545
Ig strand A 247..250 CDD:409545
Ig strand A' 260..264 CDD:409545
Ig strand B 267..274 CDD:409545
Ig strand C 282..288 CDD:409545
Ig strand C' 294..297 CDD:409545
Ig strand D 303..307 CDD:409545
Ig strand E 309..315 CDD:409545
Ig strand F 322..330 CDD:409545
Ig strand G 333..343 CDD:409545
IgC2_3_Dscam 346..426 CDD:409549 6/20 (30%)
Ig strand A 347..352 CDD:409549
Ig strand A' 355..359 CDD:409549
Ig strand B 362..372 CDD:409549
Ig strand C 377..383 CDD:409549
Ig strand C' 384..387 CDD:409549
Ig strand E 392..398 CDD:409549
Ig strand F 405..413 CDD:409549 3/7 (43%)
Ig strand G 416..426 CDD:409549 2/9 (22%)
IgI_4_Dscam 432..527 CDD:409548 20/96 (21%)
Ig strand A 432..435 CDD:409548 0/2 (0%)
Ig strand A' 441..445 CDD:409548 0/3 (0%)
Ig strand B 448..457 CDD:409548 3/8 (38%)
Ig strand C 462..468 CDD:409548 1/6 (17%)
Ig strand C' 470..473 CDD:409548 1/2 (50%)
Ig strand D 478..486 CDD:409548 1/7 (14%)
Ig strand E 490..499 CDD:409548 2/8 (25%)
Ig strand F 506..514 CDD:409548 4/7 (57%)
Ig strand G 517..527 CDD:409548 3/10 (30%)
IgI_5_Dscam 531..618 CDD:409550 20/88 (23%)
Ig strand A 531..533 CDD:409550 0/1 (0%)
Ig strand A' 538..542 CDD:409550 0/4 (0%)
Ig strand B 545..552 CDD:409550 2/6 (33%)
Ig strand C 559..565 CDD:409550 1/5 (20%)
Ig strand C' 566..568 CDD:409550 0/1 (0%)
Ig strand D 575..579 CDD:409550 1/3 (33%)
Ig strand E 582..588 CDD:409550 1/5 (20%)
Ig strand F 596..604 CDD:409550 3/7 (43%)
Ig strand G 608..618 CDD:409550 3/9 (33%)
Ig 621..718 CDD:472250 23/103 (22%)
Ig strand B 639..643 CDD:409353 0/3 (0%)
Ig strand C 653..657 CDD:409353 1/3 (33%)
Ig strand E 684..688 CDD:409353 0/3 (0%)
Ig strand F 698..703 CDD:409353 2/4 (50%)
Ig strand G 711..714 CDD:409353 0/2 (0%)
IgI_7_Dscam 721..815 CDD:409546 29/100 (29%)
Ig strand A 721..725 CDD:409546 1/3 (33%)
Ig strand A' 730..734 CDD:409546 0/3 (0%)
Ig strand B 737..746 CDD:409546 4/8 (50%)
Ig strand C 752..758 CDD:409546 1/5 (20%)
Ig strand C' 764..767 CDD:409546 1/3 (33%)
Ig strand D 775..778 CDD:409546 1/2 (50%)
Ig strand E 780..786 CDD:409546 1/5 (20%)
Ig strand F 793..801 CDD:409546 4/7 (57%)
Ig strand G 806..815 CDD:409546 1/8 (13%)
Ig 818..916 CDD:472250 21/103 (20%)
Ig strand B 836..840 CDD:409353 0/3 (0%)
Ig strand C 849..853 CDD:409353 1/3 (33%)
Ig strand E 880..884 CDD:409353 2/3 (67%)
Ig strand F 894..899 CDD:409353 1/4 (25%)
FN3 <899..1212 CDD:442628 52/234 (22%)
Ig strand G 907..910 CDD:409353 0/2 (0%)
FN3 1222..1312 CDD:238020
Ig <1339..1406 CDD:472250
Ig strand C 1350..1354 CDD:409358
Ig strand E 1372..1376 CDD:409358
Ig strand F 1386..1391 CDD:409358
Ig strand G 1399..1402 CDD:409358
FN3 1409..1499 CDD:238020
FN3 1504..1584 CDD:238020
Dscam_C 1893..2008 CDD:463546
ncam2NP_571905.1 IgI_1_NCAM-2 20..112 CDD:409452 23/112 (21%)
Ig strand A 20..25 CDD:409452 1/4 (25%)
Ig strand A' 28..32 CDD:409452 0/3 (0%)
Ig strand B 34..44 CDD:409452 4/9 (44%)
Ig strand C 48..54 CDD:409452 1/6 (17%)
Ig strand C' 57..59 CDD:409452 1/1 (100%)
Ig strand D 65..71 CDD:409452 1/10 (10%)
Ig strand E 73..81 CDD:409452 2/7 (29%)
Ig strand F 88..95 CDD:409452 3/6 (50%)
Ig strand G 100..111 CDD:409452 2/10 (20%)
Ig 131..194 CDD:409353 17/67 (25%)
Ig strand B 131..135 CDD:409353 1/3 (33%)
Ig strand C 144..148 CDD:409353 0/3 (0%)
Ig strand F 181..186 CDD:409353 2/4 (50%)
IgI_1_MuSK 213..296 CDD:409562 20/91 (22%)
Ig strand A' 215..220 CDD:409562 0/4 (0%)
Ig strand B 226..233 CDD:409562 1/6 (17%)
Ig strand C 239..244 CDD:409562 2/4 (50%)
Ig strand C' 246..248 CDD:409562 0/8 (0%)
Ig strand D 255..258 CDD:409562 0/2 (0%)
Ig strand E 262..268 CDD:409562 1/6 (17%)
Ig strand F 275..282 CDD:409562 3/6 (50%)
Ig strand G 288..296 CDD:409562 1/7 (14%)
Ig 298..395 CDD:472250 30/101 (30%)
Ig strand B 316..320 CDD:409353 1/3 (33%)
Ig strand C 329..333 CDD:409353 0/3 (0%)
Ig strand E 361..365 CDD:409353 1/3 (33%)
Ig strand F 375..380 CDD:409353 1/4 (25%)
Ig strand G 388..391 CDD:409353 0/2 (0%)
IG_like 411..488 CDD:214653 17/83 (20%)
Ig strand B 416..420 CDD:409353 0/3 (0%)
Ig strand C 429..433 CDD:409353 1/3 (33%)
Ig strand E 456..460 CDD:409353 2/3 (67%)
Ig strand F 470..475 CDD:409353 1/4 (25%)
FN3 <487..>675 CDD:442628 49/222 (22%)
FN3 494..586 CDD:238020 23/108 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.