DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dscam1 and Kirrel2

DIOPT Version :9

Sequence 1:NP_001246162.1 Gene:Dscam1 / 35652 FlyBaseID:FBgn0033159 Length:2038 Species:Drosophila melanogaster
Sequence 2:XP_038957463.1 Gene:Kirrel2 / 100359836 RGDID:1308456 Length:711 Species:Rattus norvegicus


Alignment Length:680 Identity:147/680 - (21%)
Similarity:249/680 - (36%) Gaps:140/680 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 SQHYEEDIHKAFVIRGNSAILKCDIPSFVADFVNVISWHSDEKENFYPGTEYD----GKYLVLPS 198
            |.|:.:......|:.|..|.|.|.:.:    :..::.|   .|:....|.|.|    .:|.:  |
  Rat    31 SPHFLQQPEDMVVLLGQEARLPCALGA----YRGLVQW---TKDGLALGGERDLPGWSRYWI--S 86

  Fly   199 G-------ELHIREVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVITEPVGSVSPQLSGNGNQE 256
            |       :|||:.|..|| ..||:|:     ..:..|.:...:|.:..|  ..:||:.|..:  
  Rat    87 GNSASGQHDLHIKPVELED-EASYECQ-----ASQAGLRSRPAQLHVMVP--PEAPQVLGGPS-- 141

  Fly   257 HITLTR-VPKMGSVTLMCPAQAYPVPFFRWYK---FIEGTTRKQAVVLNDRVKQVSGTLIIKDAV 317
             ::|.. ||  |::|......|.|.|...|::   .::||:..|..:.:.....|..||.:..:.
  Rat   142 -VSLVAGVP--GNLTCRSRGDARPAPELLWFRDGIRLDGTSFHQITLRDKATGTVENTLFLTPSS 203

  Fly   318 VEDSGKYLCVVNNSV--GGESVETVLTVTAPLSAKIDPPTQTVDFGRPAVFTCQYTGN-PIKTVS 379
            .:|....:|...:..  .|......|::..|....:....||...|....|.||.|.. |:....
  Rat   204 QDDGATLICRARSQALPTGRDTAVTLSLQYPPMVTLSAEPQTAQEGEKVTFLCQATAQPPVTGYR 268

  Fly   380 WMKDGK-AIGHSEPVLRIESVKKEDKGMYQCFVRNDQESAEASAELK-LGGRFDPPVIRQAFQEE 442
            |.|.|. .:|...|.|.:.:..........|.|.|...||..|..|: |.|    |:::...:..
  Rat   269 WAKGGSPVLGARGPRLEVVADATFLTEPVSCEVSNAVGSANRSTALEVLYG----PILQAKPKPV 329

  Fly   443 TMEPGPSVFLKCVAGGNPTPEISWELDGKKIANNDRYQVGQYVTVNGDVVSYLNITSVHANDGGL 507
            :::.|......||..|||.|.|||...|           |..|..:|..   |.:.||...|.|.
  Rat   330 SVDVGKDASFSCVWRGNPLPRISWTRLG-----------GSQVLSSGPT---LRLPSVALEDAGD 380

  Fly   508 YKCIAKSK---VGVAEHSAKLNVYGLPYIRQME-KKAIVAGETLIVTCPVAGYPI-DSIVWERDN 567
            |.|.|:.:   ||.....|:|.|...|.:..:. ..|.:.|...: .|.|...|. ||:||..|.
  Rat   381 YVCRAEPRRTGVGGGTAQARLTVNAPPVVTALHPAPAFLRGPARL-QCVVFASPAPDSVVWSWDE 444

  Fly   568 RALPINRKQK----VFP---------NGTLIIENVE--RNSDQAT-YTCVAKNQEGYSARGSLEV 616
            ..|......:    .||         .|.:.:.::.  :.||..| :.|.|:|:.|   .|.:::
  Rat   445 GFLEAGSLGRFLVEAFPAPEVEGGQGPGLISVLHISGTQESDFTTGFNCSARNRLG---EGRVQI 506

  Fly   617 QV---MVLPQI-----VPFAYEDLINMGDSIDLFCQIQKGDRPIKVHWSFERSAGDYGFDQVQPQ 673
            .:   .:||.:     ...|...|..:...:.|.|            |                 
  Rat   507 HLGRRDLLPTVRLVAGAASAATSLFMVITGVVLCC------------W----------------- 542

  Fly   674 MRTNRISEKTSMISIPSA---SPAHTGRDTCIASNKAGTTTYSVDLTVNVPPRWILEPTDKAFAQ 735
             |...:|::.:::.||.:   |.||...:...:|...|...::             :..|....:
  Rat   543 -RHGSLSKQKNLVRIPGSSEGSSAHGPEEETGSSEDRGPIVHT-------------DHNDLVLEE 593

  Fly   736 GSDAKVECKADGFPKPQ-VTWKKAVGDTPG 764
            ....:.:...:|:.|.: |:...::|:.||
  Rat   594 NEALETKDPTNGYYKVRGVSVSLSLGEAPG 623

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dscam1NP_001246162.1 Ig 38..130 CDD:299845
IG 57..133 CDD:214652
IG_like 267..343 CDD:214653 16/80 (20%)
Ig 269..340 CDD:143165 14/75 (19%)
IG_like 353..425 CDD:214653 20/73 (27%)
IGc2 361..413 CDD:197706 14/53 (26%)
I-set 433..527 CDD:254352 27/96 (28%)
IGc2 446..517 CDD:197706 22/73 (30%)
I-set 533..618 CDD:254352 22/102 (22%)
IGc2 544..607 CDD:197706 19/79 (24%)
Ig 641..714 CDD:143165 12/75 (16%)
IGc2 735..804 CDD:197706 6/31 (19%)
I-set 819..914 CDD:254352
Ig 833..921 CDD:299845
FN3 918..1011 CDD:238020
FN3 1018..1116 CDD:238020
FN3 1124..1217 CDD:238020
FN3 1222..1312 CDD:238020
Ig 1339..1406 CDD:299845
FN3 1409..1499 CDD:238020
FN3 1504..1584 CDD:238020
Dscam_C 1890..2008 CDD:289151
Kirrel2XP_038957463.1 IG_like 38..127 CDD:214653 24/103 (23%)
Ig strand A' 40..44 CDD:409353 0/3 (0%)
Ig strand B 48..57 CDD:409353 3/8 (38%)
Ig strand C 62..66 CDD:409353 1/6 (17%)
Ig strand D 75..85 CDD:409353 2/9 (22%)
Ig strand E 88..100 CDD:409353 3/11 (27%)
Ig strand F 107..115 CDD:409353 3/12 (25%)
Ig strand G 117..127 CDD:409353 2/9 (22%)
Ig 133..231 CDD:416386 22/102 (22%)
Ig strand A 134..137 CDD:409353 2/2 (100%)
Ig strand A' 140..144 CDD:409353 0/6 (0%)
Ig strand B 151..158 CDD:409353 1/6 (17%)
Ig strand C 164..169 CDD:409353 1/4 (25%)
Ig strand C' 172..174 CDD:409353 0/1 (0%)
Ig strand D 177..184 CDD:409353 3/6 (50%)
Ig strand E 191..199 CDD:409353 3/7 (43%)
Ig strand F 208..216 CDD:409353 1/7 (14%)
Ig strand G 222..228 CDD:409353 1/5 (20%)
Ig_3 234..303 CDD:404760 17/68 (25%)
Ig strand B 252..256 CDD:409353 1/3 (33%)
Ig strand C 266..270 CDD:409353 0/3 (0%)
Ig strand E 283..286 CDD:409353 1/2 (50%)
Ig strand F 292..301 CDD:409353 1/8 (13%)
Ig strand G 309..312 CDD:409353 0/2 (0%)
Ig 326..403 CDD:416386 26/90 (29%)
Ig strand A' 327..332 CDD:409353 0/4 (0%)
Ig strand B 335..344 CDD:409353 2/8 (25%)
Ig strand C 350..354 CDD:409353 2/3 (67%)
Ig strand C' 357..359 CDD:409353 1/12 (8%)
Ig strand D 362..365 CDD:409353 0/2 (0%)
Ig strand E 366..371 CDD:409353 1/7 (14%)
Ig strand F 379..387 CDD:409353 4/7 (57%)
Ig strand G 393..403 CDD:409353 3/9 (33%)
Ig 405..509 CDD:416386 23/107 (21%)
Ig strand A 406..410 CDD:409353 1/3 (33%)
Ig strand A' 412..415 CDD:409353 0/2 (0%)
Ig strand B 423..430 CDD:409353 1/7 (14%)
Ig strand C 437..442 CDD:409353 3/4 (75%)
Ig strand C' 444..447 CDD:409353 0/2 (0%)
Ig strand D 455..462 CDD:409353 1/6 (17%)
Ig strand E 472..479 CDD:409353 1/6 (17%)
Ig strand F 490..497 CDD:409353 2/6 (33%)
Ig strand G 500..507 CDD:409353 2/9 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 54 1.000 Domainoid score I10917
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.900

Return to query results.
Submit another query.