DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dscam1 and kirrel1b

DIOPT Version :10

Sequence 1:NP_001246162.1 Gene:Dscam1 / 35652 FlyBaseID:FBgn0033159 Length:2038 Species:Drosophila melanogaster
Sequence 2:XP_017212964.1 Gene:kirrel1b / 100170816 ZFINID:ZDB-GENE-070912-173 Length:801 Species:Danio rerio


Alignment Length:1053 Identity:213/1053 - (20%)
Similarity:335/1053 - (31%) Gaps:386/1053 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   352 DPPTQTVDFGRPAVFTC---QYTGNPIKTVSWMKDGKAIGHSEPV------------------LR 395
            :|..|:|..|...|.:|   .|||    .|.|.|||.|:|..|.:                  |.
Zfish    30 EPADQSVVIGERVVLSCVVFNYTG----IVQWTKDGLALGIGEDLRAWPRYRVLRIMDVGQYNLE 90

  Fly   396 IESVKKEDKGMYQCFVRNDQESAEASAELKLGGRFDP--PVIRQAFQEETMEPGPSVFLKCVA-G 457
            |.|....|..:|:|   ...|:|..|...||.....|  ||| :...|..:..|.|..|.||: |
Zfish    91 ITSADLTDDSLYEC---QATEAALRSRRAKLTVLIPPDGPVI-EGSPEILLTAGTSFNLTCVSRG 151

  Fly   458 GNPTPEISWELDGKKIAN--------NDRYQVGQYVTVNGDVVSYLNITSVHANDGGLYKCIAKS 514
            ..|...|.|..||..:..        :||.:|        ...|:|.|..:..:.|..:.|:|.:
Zfish   152 AKPMSTIEWYKDGIIVEGAHTSTEVLSDRKRV--------TTKSFLEIQPMDTDTGRNFTCVASN 208

  Fly   515 KVGV--AEHSAKLNVYGLP-YIRQMEKKAIVAGETLIVTC------PVAGYPIDSIVWERDNRAL 570
            ....  ...:..||::..| .|..:|.::::.||.:..||      |:.||.     |.:     
Zfish   209 LAAPLGKRSTVTLNIHHPPTVILSIEPRSVLEGERVKFTCQATANPPIMGYR-----WAK----- 263

  Fly   571 PINRKQKVFPNGTLIIENVERNSDQATYTCVAKNQEGYSARGSLEVQVMVLPQIVPFAYEDLINM 635
                       |.:|::                     .||.|:                     
Zfish   264 -----------GGVILD---------------------GARESV--------------------- 275

  Fly   636 GDSIDLFCQIQKGDRPIKVHWSFERSAGDYGFDQVQPQMRTNRISEKTSMISIPSASPAHTGRDT 700
                                  ||.:| |:.|           .:|..|                
Zfish   276 ----------------------FETTA-DHSF-----------FTEPVS---------------- 290

  Fly   701 CIASNKAGTTTYSVDLTVNVPPRWILEPTDKAFAQGSDAKVECKADGFPKPQVTWKKAVGDTPGE 765
            |:..|..|:|..|:.:.|:..|..::||........||..:.||..|.|...:||.|        
Zfish   291 CLVFNAVGSTNVSILVDVHFGPILVVEPRPVTVDVDSDVTLNCKWSGNPPLTLTWTK-------- 347

  Fly   766 YKDLKKSDNIRVEEGTLHVDNIQKTNEGYYLCEAI-NGIGSGLSAVIMISVQAPPEFTEKLRNQT 829
                |.|..:......|.:.::.:.:.|.|:|:|| ..||.| ...:.::|..||..:.: ..|.
Zfish   348 ----KGSSMVLSNSNQLFLKSVSQADAGQYVCKAIVPRIGVG-ETEVTLTVNGPPIISSE-PIQY 406

  Fly   830 ARRGEPAVLQCE-AKGEKPIGILWNMNNMRLDPKND---NRYTIREEILST---GVMSSLSIKRT 887
            |.|||...::|. |....|..|:|.......:.:..   .|||:.:...:|   .|:|:|:|...
Zfish   407 AVRGEKGEIKCYIASTPPPDKIVWAWKENVWEKERGTLLERYTVEQSRPATQGGAVLSTLTINNV 471

  Fly   888 ERSD-SALFTCVATNAFGSDDASINMIVQEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPLDRY 951
            ..:| .:.:.|.|.||||..    .||:        .|:..|.:...                  
Zfish   472 MEADFQSTYNCTAWNAFGPG----TMII--------TLEETDIASED------------------ 506

  Fly   952 IIEFKRSRASWSEIDRVIVPGHTTEAQVQKLSPATTYNIRIVAENAIGTS--------------- 1001
                             |||                  :.::|..::|:|               
Zfish   507 -----------------IVP------------------VGVIAGGSVGSSILLLLLLFALIFYLY 536

  Fly  1002 ----QSSEAVTIITAEEAPSGKPQNIKVEPVNQTTMRVTWKPPPRTEWNGEILGYYVGYKLSNTN 1062
                .|...||:         || :||||.||                                 
Zfish   537 RQRKSSRRGVTL---------KP-DIKVETVN--------------------------------- 558

  Fly  1063 SSYVFETINFITEEGKEHNLELQNLRVYTQYSVVIQAFNKIGAGPLSEEEKQFTAEGTPS-QPPS 1126
                           ||.|||.:.....|...:|...::.:.:..||           || ||..
Zfish   559 ---------------KETNLEEEAASASTATRMVKAMYSFLPSVSLS-----------PSTQPFK 597

  Fly  1127 DTACTTLTSQTIRVGWVSPPLESANGVIKTYKVVYAPSDEWYD-ETKRHYKKTASSDTVLHGLKK 1190
            |........||          |:....::.|: ...|::.:|: ....|.:..:|:.::|:...:
Zfish   598 DDMDLKQDLQT----------ETLEPKVEEYE-AKDPTNGYYNVRATTHDEVRSSTRSLLYQEFR 651

  Fly  1191 YTNYTMQVLATTAGGDGVRSVPI-HCQTEPDVPEA-PTDVKALVMGNAAILVSWRPPAQPNGIIT 1253
            ..| ...|.|:|.|...:...|. ..:..|....| .|......:..|:.:   :|||.|   ::
Zfish   652 APN-PASVSASTGGPANIHPAPTGRYEARPTSRMAHNTYAHFNTIARASQI---QPPANP---VS 709

  Fly  1254 QYTVYSKAEGAETETKT--------QKVPHYQMSFEATELEKNKPYEFWVTASTTIGEG---QQS 1307
            :.|.|....|....|..        ...|.|::.| |..||....||.:.|     |:|   .|.
Zfish   710 KTTDYPAERGLLESTNPLAFDSYAYSTTPQYRLGF-APPLEAGPAYEMYPT-----GQGVGTSQD 768

  Fly  1308 KSIVAMPSD-QVP 1319
            .::...||. |.|
Zfish   769 ANVGKYPSSAQFP 781

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dscam1NP_001246162.1 IgI_1_Dscam 38..136 CDD:409547
Ig strand A 39..42 CDD:409547
Ig strand A' 48..52 CDD:409547
Ig strand B 55..64 CDD:409547
Ig strand C 70..76 CDD:409547
Ig strand C' 78..81 CDD:409547
Ig strand D 87..90 CDD:409547
Ig strand E 95..100 CDD:409547
Ig strand F 113..121 CDD:409547
Ig strand G 124..136 CDD:409547
IgI_2_Dscam 246..343 CDD:409545
Ig strand A 247..250 CDD:409545
Ig strand A' 260..264 CDD:409545
Ig strand B 267..274 CDD:409545
Ig strand C 282..288 CDD:409545
Ig strand C' 294..297 CDD:409545
Ig strand D 303..307 CDD:409545
Ig strand E 309..315 CDD:409545
Ig strand F 322..330 CDD:409545
Ig strand G 333..343 CDD:409545
IgC2_3_Dscam 346..426 CDD:409549 26/94 (28%)
Ig strand A 347..352 CDD:409549 213/1053 (20%)
Ig strand A' 355..359 CDD:409549 1/3 (33%)
Ig strand B 362..372 CDD:409549 3/12 (25%)
Ig strand C 377..383 CDD:409549 2/5 (40%)
Ig strand C' 384..387 CDD:409549 1/2 (50%)
Ig strand E 392..398 CDD:409549 2/23 (9%)
Ig strand F 405..413 CDD:409549 2/7 (29%)
Ig strand G 416..426 CDD:409549 3/9 (33%)
IgI_4_Dscam 432..527 CDD:409548 26/107 (24%)
Ig strand A 432..435 CDD:409548 2/4 (50%)
Ig strand A' 441..445 CDD:409548 1/3 (33%)
Ig strand B 448..457 CDD:409548 4/9 (44%)
Ig strand C 462..468 CDD:409548 2/5 (40%)
Ig strand C' 470..473 CDD:409548 1/2 (50%)
Ig strand D 478..486 CDD:409548 2/7 (29%)
Ig strand E 490..499 CDD:409548 3/8 (38%)
Ig strand F 506..514 CDD:409548 2/7 (29%)
Ig strand G 517..527 CDD:409548 1/11 (9%)
IgI_5_Dscam 531..618 CDD:409550 16/93 (17%)
Ig strand A 531..533 CDD:409550 1/2 (50%)
Ig strand A' 538..542 CDD:409550 0/3 (0%)
Ig strand B 545..552 CDD:409550 3/12 (25%)
Ig strand C 559..565 CDD:409550 1/5 (20%)
Ig strand C' 566..568 CDD:409550 0/1 (0%)
Ig strand D 575..579 CDD:409550 0/3 (0%)
Ig strand E 582..588 CDD:409550 2/5 (40%)
Ig strand F 596..604 CDD:409550 0/7 (0%)
Ig strand G 608..618 CDD:409550 3/9 (33%)
Ig 621..718 CDD:472250 12/96 (13%)
Ig strand B 639..643 CDD:409353 0/3 (0%)
Ig strand C 653..657 CDD:409353 0/3 (0%)
Ig strand E 684..688 CDD:409353 1/3 (33%)
Ig strand F 698..703 CDD:409353 1/4 (25%)
Ig strand G 711..714 CDD:409353 0/2 (0%)
IgI_7_Dscam 721..815 CDD:409546 23/94 (24%)
Ig strand A 721..725 CDD:409546 1/3 (33%)
Ig strand A' 730..734 CDD:409546 0/3 (0%)
Ig strand B 737..746 CDD:409546 4/8 (50%)
Ig strand C 752..758 CDD:409546 2/5 (40%)
Ig strand C' 764..767 CDD:409546 0/2 (0%)
Ig strand D 775..778 CDD:409546 0/2 (0%)
Ig strand E 780..786 CDD:409546 1/5 (20%)
Ig strand F 793..801 CDD:409546 5/8 (63%)
Ig strand G 806..815 CDD:409546 1/8 (13%)
Ig 818..916 CDD:472250 29/105 (28%)
Ig strand B 836..840 CDD:409353 0/3 (0%)
Ig strand C 849..853 CDD:409353 1/3 (33%)
Ig strand E 880..884 CDD:409353 2/3 (67%)
Ig strand F 894..899 CDD:409353 1/4 (25%)
FN3 <899..1212 CDD:442628 54/333 (16%)
Ig strand G 907..910 CDD:409353 0/2 (0%)
FN3 1222..1312 CDD:238020 23/101 (23%)
Ig <1339..1406 CDD:472250
Ig strand C 1350..1354 CDD:409358
Ig strand E 1372..1376 CDD:409358
Ig strand F 1386..1391 CDD:409358
Ig strand G 1399..1402 CDD:409358
FN3 1409..1499 CDD:238020
FN3 1504..1584 CDD:238020
Dscam_C 1893..2008 CDD:463546
kirrel1bXP_017212964.1 Ig 25..120 CDD:472250 28/96 (29%)
Ig strand B 42..46 CDD:409387 1/3 (33%)
Ig strand C 55..58 CDD:409387 1/2 (50%)
Ig strand E 82..86 CDD:409387 0/3 (0%)
Ig strand F 101..106 CDD:409387 2/7 (29%)
Ig strand G 113..116 CDD:409387 1/2 (50%)
Ig 127..223 CDD:472250 25/104 (24%)
Ig strand B 143..147 CDD:409416 1/3 (33%)
Ig strand C 157..161 CDD:409416 1/3 (33%)
Ig strand E 187..191 CDD:409416 2/3 (67%)
Ig strand F 201..206 CDD:409416 1/4 (25%)
Ig strand G 216..219 CDD:409416 0/2 (0%)
Ig_3 226..>286 CDD:464046 21/156 (13%)
Ig_3 312..377 CDD:464046 18/76 (24%)
IgI_5_KIRREL3 395..498 CDD:409479 29/115 (25%)
Ig strand A 396..400 CDD:409479 2/3 (67%)
Ig strand A' 402..405 CDD:409479 0/3 (0%)
Ig strand B 413..420 CDD:409479 1/6 (17%)
Ig strand C 427..432 CDD:409479 2/4 (50%)
Ig strand C' 434..437 CDD:409479 0/2 (0%)
Ig strand D 448..455 CDD:409479 2/6 (33%)
Ig strand E 461..468 CDD:409479 3/6 (50%)
Ig strand F 479..486 CDD:409479 2/6 (33%)
Ig strand G 489..496 CDD:409479 3/18 (17%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.