DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12164 and CG15615

DIOPT Version :9

Sequence 1:NP_001286157.1 Gene:CG12164 / 35651 FlyBaseID:FBgn0033158 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_611159.2 Gene:CG15615 / 36882 FlyBaseID:FBgn0034159 Length:363 Species:Drosophila melanogaster


Alignment Length:318 Identity:127/318 - (39%)
Similarity:157/318 - (49%) Gaps:110/318 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 YAHPPEGVWKKKLTWKEDWVQVWKTVKKEAWETKWKKVSVPIWKEVKVPVWKEEKVPDWKIVKKP 85
            :.|...|.||||:||||.|.::|...||:.|...|||    ||                      
  Fly    74 HEHHDPGYWKKKVTWKEGWKKIWNPAKKQIWNPSWKK----IW---------------------- 112

  Fly    86 KIEEREVPAWKEVKVAEWKKITKPIWVPTKVAVWKEIQVPIWKEVQVPYWKEIQVPIWKEVQVAD 150
                                  ||.||  ||..|||||||.||::.||:||||.||.||::||.|
  Fly   113 ----------------------KPHWV--KVPGWKEIQVPAWKQIWVPHWKEILVPAWKDIQVPD 153

  Fly   151 WKQMFEPQWVKMGIPGEKFLGKDHEGWEYTSHDLWRKKLIWKPVWKKVWRTEKKQEWKTEKKQEW 215
            :||::.|:.||:||||||:||||||||||||||||:||::||..|||:|:..|||.|..|     
  Fly   154 YKQIWTPELVKVGIPGEKYLGKDHEGWEYTSHDLWKKKVVWKSHWKKIWKPAKKQIWVPE----- 213

  Fly   216 RTEKKQEWKTEKVQEWKQDKKLEWKDEWIQVWKPVKKQIWIKEKRETWIEEKVQIWRTEKRQVWA 280
                               ||||||:.|.|.|||.||:||                         
  Fly   214 -------------------KKLEWKEAWKQYWKPAKKEIW------------------------- 234

  Fly   281 TEKRQAWKDEWQSVNVPVWKEVKVQEWKKVWKPVWEKVWVPV---------SHGHGWD 329
            |:|.: ||:.|:.:.||.|||:.|..|||:||||....|.|.         .| |.||
  Fly   235 TDKLE-WKEAWKQIWVPGWKEIWVPGWKKIWKPVVISEWFPSPDHHDHHHHEH-HDWD 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12164NP_001286157.1 DUF4816 28..70 CDD:292704 18/41 (44%)
DUF4816 184..225 CDD:292704 15/40 (38%)
DUF4816 234..273 CDD:292704 15/38 (39%)
DUF4816 282..322 CDD:292704 18/39 (46%)
CG15615NP_611159.2 DUF4816 81..119 CDD:292704 22/87 (25%)
DUF4816 123..160 CDD:292704 23/36 (64%)
DUF4816 187..228 CDD:292704 24/64 (38%)
DUF4816 233..274 CDD:292704 21/66 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468966
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D102002at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm48815
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21698
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.