DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Br140 and SNT2

DIOPT Version :9

Sequence 1:NP_001286155.1 Gene:Br140 / 35648 FlyBaseID:FBgn0033155 Length:1430 Species:Drosophila melanogaster
Sequence 2:NP_011384.1 Gene:SNT2 / 852746 SGDID:S000003099 Length:1403 Species:Saccharomyces cerevisiae


Alignment Length:222 Identity:57/222 - (25%)
Similarity:92/222 - (41%) Gaps:48/222 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   286 CCICLDGECQNTNVILFCDMCNLAVHQDCYGVPYIPEG----------QWLCRRCLQ--SP--SK 336
            |.:|.:....|.|..:.|..|.|.||..||.:. :|:.          :|||..|..  :|  |.
Yeast  1041 CSVCKEKFNDNDNYEVVCGNCGLTVHYFCYAIK-LPKDMKKNTNLKTFKWLCDPCSNDLNPIIST 1104

  Fly   337 PVNCVLCPN---------------AGGAFKQTDHGQWAHVVCALWIPEVRFANTVFLEPIDSIET 386
            ...|.:||.               ...|.|.|..|.|.|:||:|:..::::.|...::|..:...
Yeast  1105 TYQCSMCPTKDYDYDRYRSQSFKICPDALKCTSLGTWVHLVCSLFNEDIKYGNGQSMQPALNTTA 1169

  Fly   387 IPPARWRLTCYVCKEKGLGACIQCHRNSCYAAFHVTCAQQAGLY--------MTMDT----VKDG 439
            :.....|.||.||:..| |..::|  |.|...:|:||||.:..:        |::||    :||.
Yeast  1170 VLIKHSRFTCGVCRING-GGLVKC--NKCQYRYHITCAQNSSNFKLMFEKKNMSVDTTLPCIKDV 1231

  Fly   440 HNDSSMHVQKFAYCHAHTPADAKLKMN 466
            ..:.:..::....|..|   |..|:.|
Yeast  1232 KLNDTYTLRPILICDRH---DISLEGN 1255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Br140NP_001286155.1 EPL1 <192..264 CDD:287484
PHD_BRPF 283..336 CDD:277047 17/63 (27%)
ePHD_BRPF 340..456 CDD:277140 35/142 (25%)
Bromo_brd1_like 615..712 CDD:99944
BR140_related 1303..1414 CDD:99900
SNT2NP_011384.1 BAH_fungalPHD 112..256 CDD:240061
PHD1_Snt2p_like 319..366 CDD:276972
Myb_DNA-binding 559..602 CDD:395191
PHD2_Snt2p_like 1040..1094 CDD:276973 15/53 (28%)
ePHD_Snt2p_like 1108..1248 CDD:277137 35/142 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5141
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.