DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Br140 and AT3G14740

DIOPT Version :9

Sequence 1:NP_001286155.1 Gene:Br140 / 35648 FlyBaseID:FBgn0033155 Length:1430 Species:Drosophila melanogaster
Sequence 2:NP_974313.1 Gene:AT3G14740 / 820702 AraportID:AT3G14740 Length:343 Species:Arabidopsis thaliana


Alignment Length:254 Identity:87/254 - (34%)
Similarity:123/254 - (48%) Gaps:43/254 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   212 EKSLEE---LDGEVEYDVDEEDSAWLEHMNEERQRLGLNAVGIDTMELLMDRLEKESHFQAAANG 273
            |||:|:   |:.|...:|:|:|.      .|....||....        :|..::|         
plant   103 EKSIEKKSTLNVESSLEVEEDDD------KENIDPLGKGKA--------LDLSDRE--------- 144

  Fly   274 TPTGVEVDDDAVCCICLDGECQNTNVILFCDMCNLAVHQDCYGVPY---IPEGQWLCRRCLQSPS 335
                ||.:|..:|.:|...:....|.|:|||.|:|.||..|||.|.   ||||.|.||:||.|.:
plant   145 ----VEDEDGIMCAVCQSTDGDPLNPIVFCDGCDLMVHASCYGNPLVKAIPEGDWFCRQCLSSKN 205

  Fly   336 --KPVNCVLCPNAGGAFKQTDHGQWAHVVCALWIPEVRFANTVFLEPIDSIETIPPARWRLTCYV 398
              |..:|.||...|||.|.|:.|:|||:.|||::|||.|.:....|.|...|.: ..||:..||:
plant   206 REKIFSCCLCTTKGGAMKPTNDGRWAHITCALFVPEVYFEDPEGREGICCSEVL-SKRWKDRCYL 269

  Fly   399 CKEKGLGACIQCHRNSCYAAFHVTCAQQAGLYMTMDTVKDGHNDSSMHVQKFAYCHAHT 457
            ||.: .|..|:|....|..||||||..:..|.:   ..::|.....:.|   .:|:.||
plant   270 CKVR-RGCVIECSEMRCKLAFHVTCGLKEDLCI---EYREGKKSGGIVV---GFCNEHT 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Br140NP_001286155.1 EPL1 <192..264 CDD:287484 13/54 (24%)
PHD_BRPF 283..336 CDD:277047 25/57 (44%)
ePHD_BRPF 340..456 CDD:277140 42/115 (37%)
Bromo_brd1_like 615..712 CDD:99944
BR140_related 1303..1414 CDD:99900
AT3G14740NP_974313.1 COG5141 <144..>323 CDD:227470 74/199 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5141
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3222
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.