DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Br140 and KDM4D

DIOPT Version :9

Sequence 1:	NP_001286155.1	Gene:	Br140 / 35648	FlyBaseID:	FBgn0033155	Length:	1430	Species:	Drosophila melanogaster
Sequence 2:	NP_060509.2	Gene:	KDM4D / 55693	HGNCID:	25498	Length:	523	Species:	Homo sapiens

Alignment Length:	138	Identity:	37/138 - (26%)
Similarity:	50/138 - (36%)	Gaps:	35/138 - (25%)

- Green bases have known domain annotations that are detailed below.

  Fly  1185 RPLSARQNKPMKVGTRGTPTPTTMARAVALSAG-RGRGKRRSNLSESTSSTATPPPLRRAGKLRS 1248
            :|.:|..:...|..:..:.||...|:.:..|.| ||||:              ||...||.:|..
Human   417 QPRAAAVHSSKKPSSTPSSTPGPSAQIIHPSNGRRGRGR--------------PPQKLRAQELTL 467

  Fly  1249 ATPNASPLVNNIKARRNTTAAGSAPLTNNNRSKHSEDSASSERHNNHSHG-QKPALEPLQLVWAK 1312
            .||...||:    |....||:|..|      ....||.|..::....|.| |.|         .|
Human   468 QTPAKRPLL----AGTTCTASGPEP------EPLPEDGALMDKPVPLSPGLQHP---------VK 513

  Fly  1313 CRGYPWYP 1320
            ..|..|.|
Human   514 ASGCSWAP 521

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Br140	NP_001286155.1	EPL1	<192..264	CDD:287484
		PHD_BRPF	283..336	CDD:277047
		ePHD_BRPF	340..456	CDD:277140
		Bromo_brd1_like	615..712	CDD:99944
		BR140_related	1303..1414	CDD:99900	4/18 (22%)
KDM4D	NP_060509.2	JmjN	19..53	CDD:280526
		JmjC	179..295	CDD:202224
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	407..523		37/138 (27%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG5141
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900