DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Br140 and Kdm4B

DIOPT Version :9

Sequence 1:NP_001286155.1 Gene:Br140 / 35648 FlyBaseID:FBgn0033155 Length:1430 Species:Drosophila melanogaster
Sequence 2:NP_001260942.1 Gene:Kdm4B / 318918 FlyBaseID:FBgn0053182 Length:717 Species:Drosophila melanogaster


Alignment Length:286 Identity:67/286 - (23%)
Similarity:110/286 - (38%) Gaps:47/286 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   746 LLLAAPASEGIVQKLLILADKSQVLK-NPTYRTKKIKQIR--LEISRMR---------KSLQKAR 798
            :|.|||....:.   ::|.||....: ||| :.|..|:..  |::..::         |::.|..
  Fly   347 VLSAAPLPPHLD---VLLCDKKMKKQCNPT-KAKSFKERNPDLDLDEIQQNPNVPDDVKAMLKES 407

  Fly   799 FAARHSSHANQSQSD--DEDTLG-GSPSKKRTRKRFNSSGVDMELGHDDDDEEED---------S 851
            .....:......::|  :||.:. .||:..:|::.....   ::.|.:|||||||         .
  Fly   408 VLTLDTGDLATDEADFPNEDAMSLQSPANLKTKQELLEY---IDDGTEDDDEEEDFKRRKQKRRY 469

  Fly   852 DEDSMGEDTVSKDLLNSTQTPPCSPIKSLNNSSSPV--------GINRRTAILLTRKAQAALKRP 908
            |.|...:...||...||......||....:.|.||.        |..|..|....||..|..|:.
  Fly   470 DADYDDDWLASKRKTNSRNNRGRSPRTKDDRSISPASSTSSTSRGARRGKASGTPRKTPARRKKD 534

  Fly   909 SEPLTTPVKEEQHNSQSSNTQSTSGSSSSVTTAATAASSGAG-------TLNHVLSSAPPTASSF 966
            | ..|:|.......:..:.|.:....::|:.|..|..:.|.|       :|..:..|........
  Fly   535 S-ITTSPAVSSAATAVKTPTSAVVAGTTSIATTTTPPADGGGDAKKERQSLQFMQQSRKFEGKIP 598

  Fly   967 ALTQNNSSGGGALASGTGIGGSSSAG 992
            .|:|.:::.|||.|:.......||.|
  Fly   599 KLSQTSAATGGATAAAEASTSKSSQG 624

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Br140NP_001286155.1 EPL1 <192..264 CDD:287484
PHD_BRPF 283..336 CDD:277047
ePHD_BRPF 340..456 CDD:277140
Bromo_brd1_like 615..712 CDD:99944
BR140_related 1303..1414 CDD:99900
Kdm4BNP_001260942.1 JmjN 11..44 CDD:280526
JmjC 173..289 CDD:202224
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5141
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.