DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Br140 and snt2

DIOPT Version :9

Sequence 1:NP_001286155.1 Gene:Br140 / 35648 FlyBaseID:FBgn0033155 Length:1430 Species:Drosophila melanogaster
Sequence 2:NP_593554.1 Gene:snt2 / 2543443 PomBaseID:SPAC3H1.12c Length:1131 Species:Schizosaccharomyces pombe


Alignment Length:344 Identity:80/344 - (23%)
Similarity:127/344 - (36%) Gaps:85/344 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   170 APPLEENAP----------------WARVQVPVARVAEIPDYRVSDAPPRPLAYYRFIEKSLEEL 218
            |||:||::|                |.....|:.: |...|.|..|..|        ::|...:.
pombe   684 APPIEESSPKDKSKIVALCQRCGYVWRYYGYPLQQ-ATPSDLRNCDFEP--------VKKRKADW 739

  Fly   219 DGEVEYD--VDEEDSAWLEHMNEERQRLGLNAVGIDTMELLMD---RLEKESHFQAAANGTPTGV 278
            |....:|  |.:|::. :.:.:...:...::....|...|..|   .::.::..:|..|......
pombe   740 DHLSNHDNEVKKENNR-IRNASSLMENPRVSTKTFDNFTLTHDSTINVKADTVKRARQNNIKNKD 803

  Fly   279 EV---DDDAVCC-ICLDGECQNTNVILFCDMCNLAVHQDCY------------------------ 315
            :|   :|...|| :|   ....|..:|.|..|...||:.||                        
pombe   804 DVNFSEDRKKCCALC---GIVGTEGLLVCFKCGTCVHERCYVCDDYAENEQMLVSASHLSGRTTR 865

  Fly   316 --GVPYIPEGQ-----------WLCRRCLQSPSKPVN----CVLCPNAG--GAFKQTDHGQWAHV 361
              ..|.|..|:           |.|..|..:.:...|    ||||..:.  ...|:|..|.|.|:
pombe   866 NSASPGIVSGKKSYAKKDQVLSWACLSCRSNDNLGQNNDNHCVLCLQSASHSLMKKTVEGNWVHL 930

  Fly   362 VCALWIPEVRFANTVFLEPIDSIETIPPARWRLTCYVCKEKGLGACIQCHRNSCYAAFHVTCAQQ 426
            :||.|.|:| :......||:..|..:||.||...|.|| ....|.|:....:...:  |||||::
pombe   931 ICASWTPDV-YVPAEESEPVCGIAQLPPNRWEKKCEVC-GNSFGVCVSSPNSGLTS--HVTCAEK 991

  Fly   427 AGLYMTMDTVKDGHNDSSM 445
            |..|:..:.||...:..||
pombe   992 ANWYLGFEFVKQDQSPFSM 1010

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Br140NP_001286155.1 EPL1 <192..264 CDD:287484 12/76 (16%)
PHD_BRPF 283..336 CDD:277047 17/90 (19%)
ePHD_BRPF 340..456 CDD:277140 37/108 (34%)
Bromo_brd1_like 615..712 CDD:99944
BR140_related 1303..1414 CDD:99900
snt2NP_593554.1 BAH_fungalPHD 94..220 CDD:240061
PHD1_Snt2p_like 261..308 CDD:276972
ePHD 907..1000 CDD:277046 33/96 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5141
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001002
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.