DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Br140 and Kdm4d

DIOPT Version :9

Sequence 1:NP_001286155.1 Gene:Br140 / 35648 FlyBaseID:FBgn0033155 Length:1430 Species:Drosophila melanogaster
Sequence 2:NP_775609.2 Gene:Kdm4d / 244694 MGIID:3606484 Length:510 Species:Mus musculus


Alignment Length:207 Identity:46/207 - (22%)
Similarity:78/207 - (37%) Gaps:60/207 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   995 AAASLTSTALAMNSKLSANLPVKSPKRPGRYRRVPEVRHSSSMSPKKSPNPAVTVSQALPMPETL 1059
            |....|.|.::.:.:|:.....|:|::....:|: .:|..|     :|..|..|||         
Mouse   340 AVVDHTETMVSTSQELTTRRVTKAPRKTWGLKRL-RLRQVS-----RSLLPIATVS--------- 389

  Fly  1060 PFERIPDSFRVYRANNQ------RDVSDSDDAPSQSSSPCSSCSDFSMS-GSCS------DFDSD 1111
               .:|.:.:|...:.|      .||..||.|.: |..|.|..|...|| ..||      :..:.
Mouse   390 ---NVPCNMQVCHTSRQPSDVKGDDVQKSDSARA-SPHPLSLPSSGHMSTRRCSLGRRPCELGAQ 450

  Fly  1112 EASEGDADGDPDRDGGRSRSEERDSTSQEGTTDAMDMQHASLNNVQGNNGNMAISSS-------- 1168
            |:|    :|.|.:   |.....||.||     .:.::|      .|..:|::.:.|.        
Mouse   451 ESS----NGAPVK---RQLPAGRDDTS-----PSPELQ------PQAVSGDLIVDSGLVNPGPQH 497

  Fly  1169 --SGGSGGSSSE 1178
              :...||.:|:
Mouse   498 LMTASEGGLTSD 509

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Br140NP_001286155.1 EPL1 <192..264 CDD:287484
PHD_BRPF 283..336 CDD:277047
ePHD_BRPF 340..456 CDD:277140
Bromo_brd1_like 615..712 CDD:99944
BR140_related 1303..1414 CDD:99900
Kdm4dNP_775609.2 JmjN 15..55 CDD:128818
JmjC 176..292 CDD:334913
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 397..510 31/132 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5141
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.