Sequence 1: | NP_001286155.1 | Gene: | Br140 / 35648 | FlyBaseID: | FBgn0033155 | Length: | 1430 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_775609.2 | Gene: | Kdm4d / 244694 | MGIID: | 3606484 | Length: | 510 | Species: | Mus musculus |
Alignment Length: | 207 | Identity: | 46/207 - (22%) |
---|---|---|---|
Similarity: | 78/207 - (37%) | Gaps: | 60/207 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 995 AAASLTSTALAMNSKLSANLPVKSPKRPGRYRRVPEVRHSSSMSPKKSPNPAVTVSQALPMPETL 1059
Fly 1060 PFERIPDSFRVYRANNQ------RDVSDSDDAPSQSSSPCSSCSDFSMS-GSCS------DFDSD 1111
Fly 1112 EASEGDADGDPDRDGGRSRSEERDSTSQEGTTDAMDMQHASLNNVQGNNGNMAISSS-------- 1168
Fly 1169 --SGGSGGSSSE 1178 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Br140 | NP_001286155.1 | EPL1 | <192..264 | CDD:287484 | |
PHD_BRPF | 283..336 | CDD:277047 | |||
ePHD_BRPF | 340..456 | CDD:277140 | |||
Bromo_brd1_like | 615..712 | CDD:99944 | |||
BR140_related | 1303..1414 | CDD:99900 | |||
Kdm4d | NP_775609.2 | JmjN | 15..55 | CDD:128818 | |
JmjC | 176..292 | CDD:334913 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 397..510 | 31/132 (23%) | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5141 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |