DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gadd45 and LOC797032

DIOPT Version :9

Sequence 1:NP_610264.1 Gene:Gadd45 / 35646 FlyBaseID:FBgn0033153 Length:163 Species:Drosophila melanogaster
Sequence 2:XP_001337468.2 Gene:LOC797032 / 797032 -ID:- Length:209 Species:Danio rerio


Alignment Length:143 Identity:41/143 - (28%)
Similarity:72/143 - (50%) Gaps:24/143 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 GRTIKSALLRAQSEARVIVGLSAAINVLSKSPEGSLFCLMAQPK-DGDSATHMHEVLLEAFCYEN 95
            |:.:..|||.|::|.|:.||:.....::::.|:...|||:|... :.|.|..:|..|::|||::|
Zfish    76 GKALSEALLSAKAEGRLTVGVYECAKIMNEDPDSVSFCLLATDDFECDIALQIHFTLIQAFCFDN 140

  Fly    96 DIYVIKVDDATKLSRIL---GQDSVESCCLV----QKVWADAPEEQLTKAENQLVDYCEA----- 148
            ||.:::|:|..:|:.::   ||.....|.|:    :..|.|...|:|..       :||.     
Zfish   141 DISIVRVNDLKRLNALVGGKGQLEEAHCVLITNPTEDSWEDPALEKLHL-------FCEESRSYN 198

  Fly   149 HWDAPQQPIVQLP 161
            .|    .|.:.||
Zfish   199 EW----VPEITLP 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gadd45NP_610264.1 None
LOC797032XP_001337468.2 Ribosomal_L7Ae 77..>158 CDD:294400 26/80 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 54 1.000 Domainoid score I11195
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 60 1.000 Inparanoid score I5396
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001094
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10411
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X821
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
77.060

Return to query results.
Submit another query.