DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gadd45 and gadd45g

DIOPT Version :9

Sequence 1:NP_610264.1 Gene:Gadd45 / 35646 FlyBaseID:FBgn0033153 Length:163 Species:Drosophila melanogaster
Sequence 2:NP_001004986.1 Gene:gadd45g / 448442 XenbaseID:XB-GENE-481955 Length:159 Species:Xenopus tropicalis


Alignment Length:136 Identity:41/136 - (30%)
Similarity:71/136 - (52%) Gaps:12/136 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LERELDLELEIDMAMECAPIGRTIKSALLRAQSEARVIVGLSAAINVLSKSPEGSLFCLMAQPK- 75
            ||.....|..::.|......|:.:...|:.||.|..:.||:..:..|::..|:...||::|..: 
 Frog     3 LEEVHGQETVVESADRMQTAGKALHELLVSAQREECLTVGVYESAKVMNVDPDSVTFCILAADEY 67

  Fly    76 -DGDSATHMHEVLLEAFCYENDIYVIKVDDATKLSRILG--QDSVE----SCCLV----QKVWAD 129
             :||.|..:|..|::|||.||||.:::::|..|:::|||  .:|.|    .|.|:    :..|.|
 Frog    68 DEGDIALQIHFTLIQAFCCENDINIVRLNDTEKVAQILGLTDESAEPKDLHCILITNPNEDAWKD 132

  Fly   130 APEEQL 135
            ...|:|
 Frog   133 PALEKL 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gadd45NP_610264.1 None
gadd45gNP_001004986.1 Ribosomal_L7Ae 24..>107 CDD:321063 27/82 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 60 1.000 Domainoid score I10400
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 66 1.000 Inparanoid score I5178
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1517160at2759
OrthoFinder 1 1.000 - - FOG0001094
OrthoInspector 1 1.000 - - otm49210
Panther 1 1.100 - - O PTHR10411
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4846
SonicParanoid 1 1.000 - - X821
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1010.100

Return to query results.
Submit another query.