DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gadd45 and gadd45ab

DIOPT Version :9

Sequence 1:NP_610264.1 Gene:Gadd45 / 35646 FlyBaseID:FBgn0033153 Length:163 Species:Drosophila melanogaster
Sequence 2:NP_001002216.1 Gene:gadd45ab / 431763 ZFINID:ZDB-GENE-040704-60 Length:156 Species:Danio rerio


Alignment Length:174 Identity:43/174 - (24%)
Similarity:77/174 - (44%) Gaps:33/174 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVVEENCSMHHLERELDLELEIDMAMECAPIGRTIKSALLRAQSEARVIVGLSAAINVLSKSPEG 65
            |..||.|..:..||...:|             :.::..|..|..:..:.||:..|...|:..|:.
Zfish     1 MTFEEPCGDNATERMDSVE-------------KALEEVLTAALPQGCITVGVYEAAKSLNVDPDN 52

  Fly    66 SLFCLMAQPKDG--DSATHMHEVLLEAFCYENDIYVIKVDDATKLSRIL-----GQDSVESCCLV 123
            .:.||:|..::.  |.|..:|..|::|||.||||.:::|::..:|:.||     |.:|::..|::
Zfish    53 VVLCLLATDEEDVKDVALQIHFTLIQAFCCENDINILRVNNMRRLAEILEGMKPGGESMDLHCVL 117

  Fly   124 -----QKVWADAPEEQLTKAENQLVDYCEAHWDAPQ-QPIVQLP 161
                 ...|.|....:|.:       :|.......| .|::.||
Zfish   118 VTNPQSSTWKDPALSKLNR-------FCRDSRGLDQWVPVINLP 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gadd45NP_610264.1 None
gadd45abNP_001002216.1 Ribosomal_L7Ae 20..>101 CDD:279573 23/80 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592713
Domainoid 1 1.000 54 1.000 Domainoid score I11195
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 60 1.000 Inparanoid score I5396
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1517160at2759
OrthoFinder 1 1.000 - - FOG0001094
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10411
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X821
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
99.000

Return to query results.
Submit another query.