DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gadd45 and gadd45gb.1

DIOPT Version :9

Sequence 1:NP_610264.1 Gene:Gadd45 / 35646 FlyBaseID:FBgn0033153 Length:163 Species:Drosophila melanogaster
Sequence 2:NP_998391.1 Gene:gadd45gb.1 / 406507 ZFINID:ZDB-GENE-040426-2321 Length:155 Species:Danio rerio


Alignment Length:147 Identity:41/147 - (27%)
Similarity:77/147 - (52%) Gaps:21/147 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 ECAPIGRTIKSALLRAQSEARVIVGLSAAINVLSKSPEGSLFCLMA--QPKDGDSATHMHEVLLE 89
            :|: .|:.::..|:.|::...:.:|:..:..|::..|:...||::|  :..:.|.|..:|..|::
Zfish    16 QCS-AGKALEEVLVSAKANDSLTIGVYESAKVMNVDPDSVSFCVLAVDEEFECDIALQIHFTLIQ 79

  Fly    90 AFCYENDIYVIKVDDATKLSRILGQDSVES-----CCLVQKVWADAPEEQLTKAENQLVDYCEA- 148
            |||::|||.:::|:|..:||.|:| |..|.     |.|:.|...|:.|:   .|..:|..:||. 
Zfish    80 AFCFDNDISIVRVNDMQRLSDIVG-DKAEDFEDAHCVLITKPAEDSWED---PALEKLHLFCEES 140

  Fly   149 ----HWDAPQQPIVQLP 161
                .|    .|.:.||
Zfish   141 RSYNEW----VPEITLP 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gadd45NP_610264.1 None
gadd45gb.1NP_998391.1 Ribosomal_L7Ae 21..124 CDD:294400 29/103 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592709
Domainoid 1 1.000 54 1.000 Domainoid score I11195
eggNOG 1 0.900 - - E1_2C91W
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 60 1.000 Inparanoid score I5396
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1517160at2759
OrthoFinder 1 1.000 - - FOG0001094
OrthoInspector 1 1.000 - - oto39491
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10411
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4846
SonicParanoid 1 1.000 - - X821
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1211.930

Return to query results.
Submit another query.