DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gadd45 and gadd45ba

DIOPT Version :9

Sequence 1:NP_610264.1 Gene:Gadd45 / 35646 FlyBaseID:FBgn0033153 Length:163 Species:Drosophila melanogaster
Sequence 2:NP_998196.1 Gene:gadd45ba / 406304 ZFINID:ZDB-GENE-040426-1971 Length:159 Species:Danio rerio


Alignment Length:165 Identity:36/165 - (21%)
Similarity:80/165 - (48%) Gaps:32/165 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVVEENCSMHHLERELDLELEIDMAMECAPIGRTIKSALLRAQSEARVIVGLSAAINVLSKSPEG 65
            |.:||....:..:.::|            .:.:.::..|:.||.:..:.||:..:..:::..|:.
Zfish     1 MTLEEVVGCNITDTKMD------------TVSQALEELLVAAQRQDCLTVGVYESAKLMNVDPDC 53

  Fly    66 SLFCLMAQPKD--GDSATHMHEVLLEAFCYENDIYVIKVDDATKLSRILGQD-SVES-------C 120
            .:.|::|..::  .|.|..:|..||:|||.:|||.:::|....:|:::|.:. :||:       |
Zfish    54 VVLCILATDEEDLDDIALQIHFTLLQAFCCDNDINILRVSGLRRLAQVLDEPATVENSEPRDFHC 118

  Fly   121 CLV-----QKVWADAPEE-----QLTKAENQLVDY 145
            .||     |.:...|.::     :.::.:||.:.|
Zfish   119 ILVTNSQCQPLKCQALKDVGTYCEESRCKNQWIPY 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gadd45NP_610264.1 None
gadd45baNP_998196.1 Ribosomal_L7Ae 21..109 CDD:279573 22/87 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592707
Domainoid 1 1.000 54 1.000 Domainoid score I11195
eggNOG 1 0.900 - - E1_2C91W
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 60 1.000 Inparanoid score I5396
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1517160at2759
OrthoFinder 1 1.000 - - FOG0001094
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10411
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X821
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1110.860

Return to query results.
Submit another query.