DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gadd45 and gadd45ga

DIOPT Version :9

Sequence 1:NP_610264.1 Gene:Gadd45 / 35646 FlyBaseID:FBgn0033153 Length:163 Species:Drosophila melanogaster
Sequence 2:NP_991254.1 Gene:gadd45ga / 402991 ZFINID:ZDB-GENE-040426-1882 Length:159 Species:Danio rerio


Alignment Length:146 Identity:40/146 - (27%)
Similarity:73/146 - (50%) Gaps:27/146 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 GRTIKSALLRAQSEARVIVGLSAAINVLSKSPEGSLFCLMA--QPKDGDSATHMHEVLLEAFCYE 94
            |..::..|:.|:.:..:.||:..:..|::..|:...||::|  :..:.|.|..:|..|::|||::
Zfish    23 GTALEELLVSAKKQDCLTVGVYESAQVMNVDPDSVAFCVLATDEEYEYDIALQIHFTLIQAFCFD 87

  Fly    95 NDIYVIKVDDATKLSRILGQDSVES-----CCLVQK----VWADAPEEQLTKAENQLVDYCEA-- 148
            |||.:::|:|..:|:.|:|.|..|.     |.||.:    .|.|:       |.::|..:||.  
Zfish    88 NDINIVRVNDIERLADIVGCDQDEEPKDAHCILVTRPNDDSWKDS-------ALDKLGLFCEESR 145

  Fly   149 ---HWDAPQQPIVQLP 161
               .|    .|.:.||
Zfish   146 NVYEW----VPSITLP 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gadd45NP_610264.1 None
gadd45gaNP_991254.1 Ribosomal_L7Ae 24..126 CDD:279573 29/101 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592708
Domainoid 1 1.000 54 1.000 Domainoid score I11195
eggNOG 1 0.900 - - E1_2C91W
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 60 1.000 Inparanoid score I5396
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1517160at2759
OrthoFinder 1 1.000 - - FOG0001094
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_113955
Panther 1 1.100 - - O PTHR10411
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4846
SonicParanoid 1 1.000 - - X821
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1312.790

Return to query results.
Submit another query.