DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gadd45 and gadd45aa

DIOPT Version :9

Sequence 1:NP_610264.1 Gene:Gadd45 / 35646 FlyBaseID:FBgn0033153 Length:163 Species:Drosophila melanogaster
Sequence 2:NP_956870.2 Gene:gadd45aa / 393548 ZFINID:ZDB-GENE-040426-1501 Length:157 Species:Danio rerio


Alignment Length:159 Identity:40/159 - (25%)
Similarity:77/159 - (48%) Gaps:24/159 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 ELEIDMAME-CAPIGRTIKSALLRAQSEARVIVGLSAAINVLSKSPEGSLFCLMAQPKDG--DSA 80
            ||..|.::| ...:.:.::..|..|..:..:.||:..|...|:..|:..:.|::|...|.  |.|
Zfish     5 ELNGDYSIERMNSVIKALEEVLRSALPQGCITVGVYEAAKSLNVDPDNVVLCILATDDDDVKDVA 69

  Fly    81 THMHEVLLEAFCYENDIYVIKVDDATKLSRIL------GQDSVESCCLVQKV-----WADAPEEQ 134
            ..:|..|::|||.||||.:::|::..:|:.||      |.:.::..|::..|     |.:....:
Zfish    70 LQIHFTLIQAFCCENDINILRVNNTRRLANILGGAGMHGSEQMDLHCILVTVPHASTWKNPALGK 134

  Fly   135 LTK--AENQLVDYCEAHWDAPQQPIVQLP 161
            :.:  .|::.:|    .|    .||:.||
Zfish   135 VNRFCRESRCMD----QW----VPIINLP 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gadd45NP_610264.1 None
gadd45aaNP_956870.2 Ribosomal_L7Ae 20..>102 CDD:279573 24/81 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592711
Domainoid 1 1.000 54 1.000 Domainoid score I11195
eggNOG 1 0.900 - - E1_2C91W
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 60 1.000 Inparanoid score I5396
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1517160at2759
OrthoFinder 1 1.000 - - FOG0001094
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR10411
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X821
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1110.860

Return to query results.
Submit another query.