DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gadd45 and Gadd45b

DIOPT Version :9

Sequence 1:NP_610264.1 Gene:Gadd45 / 35646 FlyBaseID:FBgn0033153 Length:163 Species:Drosophila melanogaster
Sequence 2:XP_006240950.1 Gene:Gadd45b / 299626 RGDID:1309080 Length:190 Species:Rattus norvegicus


Alignment Length:107 Identity:29/107 - (27%)
Similarity:62/107 - (57%) Gaps:11/107 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 IKSALLRAQSEARVIVGLSAAINVLSKSPEGSLFCLMA--QPKDGDSATHMHEVLLEAFCYENDI 97
            ::..|:.||.:.|:.||:..|..:::..|:..:.||:|  :.::.|.|..:|..|:::||.:|||
  Rat    23 VEQLLVAAQRQDRLTVGVYEAAKLMNVDPDSVVLCLLAIDEEEEDDIALQIHFTLIQSFCCDNDI 87

  Fly    98 YVIKVDDATKLSRILGQ--------DSVESCCLVQKVWADAP 131
            .:::|....:|:::||:        ::.:..||:..| :|.|
  Rat    88 DIVRVSGMQRLAQLLGEPAETLGTNEARDLHCLLVTV-SDPP 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gadd45NP_610264.1 None
Gadd45bXP_006240950.1 Ribosomal_L7Ae 21..120 CDD:279573 24/96 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350997
Domainoid 1 1.000 57 1.000 Domainoid score I10601
eggNOG 1 0.900 - - E1_2C91W
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 63 1.000 Inparanoid score I5277
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1517160at2759
OrthoFinder 1 1.000 - - FOG0001094
OrthoInspector 1 1.000 - - otm46125
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10411
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X821
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.860

Return to query results.
Submit another query.