DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gadd45 and rps1201

DIOPT Version :9

Sequence 1:NP_610264.1 Gene:Gadd45 / 35646 FlyBaseID:FBgn0033153 Length:163 Species:Drosophila melanogaster
Sequence 2:NP_587869.1 Gene:rps1201 / 2539588 PomBaseID:SPCC962.04 Length:145 Species:Schizosaccharomyces pombe


Alignment Length:98 Identity:27/98 - (27%)
Similarity:50/98 - (51%) Gaps:13/98 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 ELEIDMAMECAPIGRTIKSALLRAQSEARVIVGLSAAINVLSKSPE--GSLFCLMAQPKDGDSAT 81
            |:|::.|   ||...:::.||......|.|..||:..|...||:.:  .:..|::.:..|.::  
pombe    16 EVEVEAA---APETVSVEDALKEVLKRALVHDGLARGIREASKALDRRQAHLCVLCESCDQEA-- 75

  Fly    82 HMHEVLLEAFCYENDIYVIKVDDATKLSRILGQ 114
              :..|:||.|.|::..:|||.|    .::||:
pombe    76 --YVKLVEALCAESETPLIKVAD----PKVLGE 102

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gadd45NP_610264.1 None
rps1201NP_587869.1 Ribosomal_L7Ae 31..126 CDD:279573 22/80 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.