DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gadd45 and Gadd45g

DIOPT Version :9

Sequence 1:NP_610264.1 Gene:Gadd45 / 35646 FlyBaseID:FBgn0033153 Length:163 Species:Drosophila melanogaster
Sequence 2:NP_035947.2 Gene:Gadd45g / 23882 MGIID:1346325 Length:159 Species:Mus musculus


Alignment Length:147 Identity:42/147 - (28%)
Similarity:69/147 - (46%) Gaps:28/147 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 GRTIKSALLRAQSEARVIVGLSAAINVLSKSPEGSLFCLMA--QPKDGDSATHMHEVLLEAFCYE 94
            |:.:...||.||.:..:..|:..:..||:..|:...||::|  :..:||.|..:|..|::|||.|
Mouse    23 GKALHELLLSAQRQGCLTAGVYESAKVLNVDPDNVTFCVLAADEEDEGDIALQIHFTLIQAFCCE 87

  Fly    95 NDIYVIKVDDATKLSRILGQDSVES------CCLV----QKVWADAPEEQLTKAENQLVDYCEA- 148
            |||.:::|.|..:|:.|:|.|....      |.|:    :..|.|...|:|:.       :||. 
Mouse    88 NDIDIVRVGDVQRLAAIVGADEEGGAPGDLHCILISNPNEDTWKDPALEKLSL-------FCEES 145

  Fly   149 ----HWDAPQQPIVQLP 161
                .|    .|.:.||
Mouse   146 RSFNDW----VPSITLP 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gadd45NP_610264.1 None
Gadd45gNP_035947.2 Ribosomal_L7Ae 24..>106 CDD:307418 27/81 (33%)
Homodimerization. /evidence=ECO:0000250 43..86 13/42 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167847444
Domainoid 1 1.000 56 1.000 Domainoid score I10960
eggNOG 1 0.900 - - E1_2C91W
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I5378
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1517160at2759
OrthoFinder 1 1.000 - - FOG0001094
OrthoInspector 1 1.000 - - otm44036
orthoMCL 1 0.900 - - OOG6_113955
Panther 1 1.100 - - O PTHR10411
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4846
SonicParanoid 1 1.000 - - X821
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.