DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gadd45 and Gadd45b

DIOPT Version :9

Sequence 1:NP_610264.1 Gene:Gadd45 / 35646 FlyBaseID:FBgn0033153 Length:163 Species:Drosophila melanogaster
Sequence 2:NP_032681.1 Gene:Gadd45b / 17873 MGIID:107776 Length:160 Species:Mus musculus


Alignment Length:124 Identity:33/124 - (26%)
Similarity:67/124 - (54%) Gaps:14/124 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 IKSALLRAQSEARVIVGLSAAINVLSKSPEGSLFCLMA--QPKDGDSATHMHEVLLEAFCYENDI 97
            ::..|:.||.:.|:.||:..|..:::..|:..:.||:|  :.::.|.|..:|..|:::||.:|||
Mouse    23 VEQLLVAAQRQDRLTVGVYEAAKLMNVDPDSVVLCLLAIDEEEEDDIALQIHFTLIQSFCCDNDI 87

  Fly    98 YVIKVDDATKLSRILGQ-----DSVES----CCLVQKVWADAPEEQLTKAENQLVDYCE 147
            .:::|....:|:::||:     .:.|:    |.||.....|:.:.|   ...::..|||
Mouse    88 DIVRVSGMQRLAQLLGEPAETLGTTEARDLHCLLVTNCHTDSWKSQ---GLVEVASYCE 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gadd45NP_610264.1 None
Gadd45bNP_032681.1 Ribosomal_L7Ae 21..120 CDD:366537 25/96 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167847445
Domainoid 1 1.000 56 1.000 Domainoid score I10960
eggNOG 1 0.900 - - E1_2C91W
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I5378
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1517160at2759
OrthoFinder 1 1.000 - - FOG0001094
OrthoInspector 1 1.000 - - otm44036
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10411
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X821
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.860

Return to query results.
Submit another query.