DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gadd45 and GADD45A

DIOPT Version :9

Sequence 1:NP_610264.1 Gene:Gadd45 / 35646 FlyBaseID:FBgn0033153 Length:163 Species:Drosophila melanogaster
Sequence 2:NP_001915.1 Gene:GADD45A / 1647 HGNCID:4095 Length:165 Species:Homo sapiens


Alignment Length:152 Identity:41/152 - (26%)
Similarity:72/152 - (47%) Gaps:28/152 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 IGRTIKSALLRAQSEARVIVGLSAAINVLSKSPEGSLFCLMAQPKDGDS--ATHMHEVLLEAFCY 93
            :|..::..|.:|.|:..:.||:..|..:|:..|:..:.||:|..:|.|.  |..:|..|::|||.
Human    19 VGDALEEVLSKALSQRTITVGVYEAAKLLNVDPDNVVLCLLAADEDDDRDVALQIHFTLIQAFCC 83

  Fly    94 ENDIYVIKVDDATKLSRIL---------GQDSVES-----CCLV----QKVWADAPEEQLTKAEN 140
            ||||.:::|.:..:|:.:|         ..:..|.     |.||    ...|.|       .|.:
Human    84 ENDINILRVSNPGRLAELLLLETDAGPAASEGAEQPPDLHCVLVTNPHSSQWKD-------PALS 141

  Fly   141 QLVDYC-EAHWDAPQQPIVQLP 161
            ||:.:| |:.:.....|::.||
Human   142 QLICFCRESRYMDQWVPVINLP 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gadd45NP_610264.1 None
GADD45ANP_001915.1 Ribosomal_L7Ae 21..123 CDD:396000 27/101 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157037
Domainoid 1 1.000 57 1.000 Domainoid score I10877
eggNOG 1 0.900 - - E1_2C91W
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 61 1.000 Inparanoid score I5391
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1517160at2759
OrthoFinder 1 1.000 - - FOG0001094
OrthoInspector 1 1.000 - - otm41986
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR10411
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X821
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1211.860

Return to query results.
Submit another query.