DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or43a and Or19a

DIOPT Version :9

Sequence 1:NP_523647.2 Gene:Or43a / 35644 FlyBaseID:FBgn0026389 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_525013.2 Gene:Or19a / 59214 FlyBaseID:FBgn0041626 Length:387 Species:Drosophila melanogaster


Alignment Length:226 Identity:51/226 - (22%)
Similarity:92/226 - (40%) Gaps:41/226 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   173 AQLPTPLLLSMMYMPFVSLFAGLAIF-GKAMLQILVH------RLGQIGGEEQSEEERFQR-LAS 229
            |.|.|.:|.:...|...:|...|:.: |..::.:.||      |:.::|........|.|. |..
  Fly   172 AYLATAMLHTTALMANATLVLNLSSYPGTYLILVSVHTKALALRVSKLGYGAPLPAVRMQAILVG 236

  Fly   230 CIAYHTQVMRYVWQLNKLV-------------ANIVAVEAIIFGSI----ICSLLFCLNIITSPT 277
            .|..|..::|....|.:.:             |.......::||::    ..::||.|.|:|:.|
  Fly   237 YIHDHQIILRLFKSLERSLSMTCFLQFFSTACAQCTICYFLLFGNVGIMRFMNMLFLLVILTTET 301

  Fly   278 QVISIVMYILTMLYVLFTYYNRANEICLENNRVAEAVYNVPWYEAGTRFRKTLLIFLMQTQHPME 342
                        |.:.:|    |...|.|...:..|||:..|......||:.||:.|.:.|.||.
  Fly   302 ------------LLLCYT----AELPCKEGESLLTAVYSCNWLSQSVNFRRLLLLMLARCQIPMI 350

  Fly   343 IRVGNVYPMTLAMFQSLLNASYSYFTMLRGV 373
            :..|.:.|:::..|..::..:|:..|:|..:
  Fly   351 LVSGVIVPISMKTFTVMIKGAYTMLTLLNEI 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or43aNP_523647.2 7tm_6 56..364 CDD:251636 48/215 (22%)
Or19aNP_525013.2 7tm_6 65..372 CDD:251636 48/215 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465770
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.