DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or43a and Or94a

DIOPT Version :9

Sequence 1:NP_523647.2 Gene:Or43a / 35644 FlyBaseID:FBgn0026389 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_524455.1 Gene:Or94a / 42711 FlyBaseID:FBgn0039033 Length:387 Species:Drosophila melanogaster


Alignment Length:392 Identity:85/392 - (21%)
Similarity:158/392 - (40%) Gaps:67/392 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 GLVGINVRMWRHLAVLYPTPGSSWRKFAFVLPVTAMNLMQFVYLLRMWGDLPAFILNMFFFSAIF 71
            |.|..|.|...||.:.:...|..|.: ||:    :.||.|...:|.|.....|.::.:.   :|:
  Fly    38 GFVKRNYRFLLHLPITFTFIGLMWLE-AFI----SSNLEQAGQVLYMSITEMALVVKIL---SIW 94

  Fly    72 NALMRTWLVIIKRRQFEEFLGQLATLFHSILDSTDEWGRGILRRAEREARNLAILNLSASFLDIV 136
            :.....|.::.:.:...::  ||    |: .:..|.|     ||.:|..:....:.:..|...:.
  Fly    95 HYRTEAWRLMYELQHAPDY--QL----HN-QEEVDFW-----RREQRFFKWFFYIYILISLGVVY 147

  Fly   137 GALVSPLFREERAHPFGLALP------------------GVSMTSSPVYEVIYLAQLPTPLLLSM 183
            ......||.|....||...:|                  |:::|      .|....|.|   |..
  Fly   148 SGCTGVLFLEGYELPFAYYVPFEWQNERRYWFAYGYDMAGMTLT------CISNITLDT---LGC 203

  Fly   184 MYMPFVSLFAGLAIFGKAMLQILVHRLGQIGGEEQSEEERF-QRLASCIAYHTQVMRYVWQLNKL 247
            .::..:||          :.::|..||.:.  :....:..| |:|.:....|.::........::
  Fly   204 YFLFHISL----------LYRLLGLRLRET--KNMKNDTIFGQQLRAIFIMHQRIRSLTLTCQRI 256

  Fly   248 VANIVAVEAIIFGSIICSLLFCL---NIITSPTQVISIVMYILTMLYVLF--TYYNRANEICLEN 307
            |:..:..:.|:...|||...:.|   .|..:|.|.||::.::..|:..::  .||  .|||.:..
  Fly   257 VSPYILSQIILSALIICFSGYRLQHVGIRDNPGQFISMLQFVSVMILQIYLPCYY--GNEITVYA 319

  Fly   308 NRVAEAVYNVPWYEAGTRFRKTLLIFLMQTQHPMEIRVGNVYPMTLAMFQSLLNASYSYFTMLRG 372
            |::...||:..|.|.....||.|..::...:.|:.||.||.:.:.|.:|...:|.:||:..:|..
  Fly   320 NQLTNEVYHTNWLECRPPIRKLLNAYMEHLKKPVTIRAGNFFAVGLPIFVKTINNAYSFLALLLN 384

  Fly   373 VT 374
            |:
  Fly   385 VS 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or43aNP_523647.2 7tm_6 56..364 CDD:251636 66/331 (20%)
Or94aNP_524455.1 7tm_6 69..376 CDD:251636 71/344 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466154
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.