DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or43a and Or92a

DIOPT Version :9

Sequence 1:NP_523647.2 Gene:Or43a / 35644 FlyBaseID:FBgn0026389 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_524414.2 Gene:Or92a / 42425 FlyBaseID:FBgn0038798 Length:408 Species:Drosophila melanogaster


Alignment Length:377 Identity:81/377 - (21%)
Similarity:150/377 - (39%) Gaps:74/377 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 YLLRMW-------------GDLPAFILNM-----------------FFFSAIFNALMRTWLVIIK 83
            ||||.:             |::..||:::                 |.|.|.|.....|    :.
  Fly    47 YLLRFYLVLGFLNFNAYVVGEIAYFIVHIMSTTTLLEATAVAPCIGFSFMADFKQFGLT----VN 107

  Fly    84 RRQFEEFLGQLATLFHSILDSTDEWGRGILRRAEREARNL-AILNL----SASFLDIVGALV--- 140
            |::....|..|..:|...|::..::.....|:.......| .||.:    |.||...:.:.:   
  Fly   108 RKRLVRLLDDLKEIFPLDLEAQRKYNVSFYRKHMNRVMTLFTILCMTYTSSFSFYPAIKSTIKYY 172

  Fly   141 ---SPLFREERAHPFGLALPGVSMTSSPVYEVIYLAQLPTPLLLSMMYMPFVSLFAGLAIFGKAM 202
               |.:|  ||.:.|.:..|..:.|...||...|..      |....|:..||......:....:
  Fly   173 LMGSEIF--ERNYGFHILFPYDAETDLTVYWFSYWG------LAHCAYVAGVSYVCVDLLLIATI 229

  Fly   203 LQILVH------RLGQIGGEEQSEEERFQRLASCIAYHTQVMRYVWQLNKLVANIVAVEAIIFGS 261
            .|:.:|      .|....|.:.::||..:.|.:.:.||.:.:    .|::.|.||.:. .|::..
  Fly   230 TQLTMHFNFIANDLEAYEGGDHTDEENIKYLHNLVVYHARAL----DLSEEVNNIFSF-LILWNF 289

  Fly   262 IICSLLFCL-NIITSPTQVISIVMYI------LTMLYVLFTYYNRANEICLENNRVAEAVYNVPW 319
            |..||:.|. ....:.:.|..||:|.      |..::|: .||  .:|:...::|:..:.:|..|
  Fly   290 IAASLVICFAGFQITASNVEDIVLYFIFFSASLVQVFVV-CYY--GDEMISSSSRIGHSAFNQNW 351

  Fly   320 YEAGTRFRKTLLIFLMQTQHPMEIRVGNVYPMTLAMFQSLLNASYSYFTMLR 371
            ....|::::.|...:.::|.|..||.....|::...|..:::.||.:|.:||
  Fly   352 LPCSTKYKRILQFIIARSQKPASIRPPTFPPISFNTFMKVISMSYQFFALLR 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or43aNP_523647.2 7tm_6 56..364 CDD:251636 71/348 (20%)
Or92aNP_524414.2 7tm_6 80..396 CDD:251636 69/335 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466125
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.