DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or43a and Or88a

DIOPT Version :9

Sequence 1:NP_523647.2 Gene:Or43a / 35644 FlyBaseID:FBgn0026389 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_524348.2 Gene:Or88a / 41715 FlyBaseID:FBgn0038203 Length:401 Species:Drosophila melanogaster


Alignment Length:365 Identity:76/365 - (20%)
Similarity:134/365 - (36%) Gaps:98/365 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 PAFILNMFFFSAIFNALMRTWLVIIKRRQFEEFLGQL-----ATLFHSILDSTDEWGRGILRRAE 117
            |...:.::|       .:|..::.:||::..||:..|     ..|...:....||..|...:|..
  Fly    82 PVLSITIYF-------SIRGLMLYLKRKEIVEFVNDLDRECPRDLVSQLDMQMDETYRNFWQRYR 139

  Fly   118 REARNLAILNLSASFLDIVGALVSPLF-----------REERAHP-------FGLALPGVSMTSS 164
                          |:.|...|..|:|           .|.:..|       .|..||.......
  Fly   140 --------------FIRIYSHLGGPMFCVVPLALFLLTHEGKDTPVAQHEQLLGGWLPCGVRKDP 190

  Fly   165 PVYEVIYLAQLPTPLLLSMMYMPFVSLFAGLAIFGKAMLQILVHRLGQIGGE------EQS--EE 221
            ..|.:::...|.........::.|.:||       ..|...||..||.:..:      .||  :|
  Fly   191 NFYLLVWSFDLMCTTCGVSFFVTFDNLF-------NVMQGHLVMHLGHLARQFSAIDPRQSLTDE 248

  Fly   222 ERF----------QRLAS--CIAYHTQVMRYVWQLNKLVANIVAVEAIIFGSIICSLLFCLNIIT 274
            :||          |:|.:  |..|:.     ::::..||:|.|...         ||.|.|.:::
  Fly   249 KRFFVDLRLLVQRQQLLNGLCRKYND-----IFKVAFLVSNFVGAG---------SLCFYLFMLS 299

  Fly   275 SPTQVISIVMYIL-TMLYVLFTYYNRANEICLENNRVAEA-------VYNVPWYEAGTRFRKTLL 331
            ..:.|:.|..||| |::.|.||:     ||||...::.:|       :.:..||....|:||..|
  Fly   300 ETSDVLIIAQYILPTLVLVGFTF-----EICLRGTQLEKASEGLESSLRSQEWYLGSRRYRKFYL 359

  Fly   332 IFLMQTQHPMEIRVGNVYPMTLAMFQSLLNASYSYFTMLR 371
            ::....|...::....:..:.:..|..::..:|..||.|:
  Fly   360 LWTQYCQRTQQLGAFGLIQVNMVHFTEIMQLAYRLFTFLK 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or43aNP_523647.2 7tm_6 56..364 CDD:251636 72/356 (20%)
Or88aNP_524348.2 7tm_6 75..392 CDD:251636 72/356 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466133
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.