DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or43a and Or85d

DIOPT Version :9

Sequence 1:NP_523647.2 Gene:Or43a / 35644 FlyBaseID:FBgn0026389 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_524281.1 Gene:Or85d / 41011 FlyBaseID:FBgn0037594 Length:412 Species:Drosophila melanogaster


Alignment Length:374 Identity:72/374 - (19%)
Similarity:154/374 - (41%) Gaps:53/374 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 WRKFAFVLPVTAMNLMQFVYLLRMWGDLPAFI---LNMFFFSAIFNALMRTWLVIIKRRQFEEFL 91
            |...|.::.:..:.:.:.:|:....|....|:   :|:.|...:.....:.|.:..:|::..:.:
  Fly    55 WTFIAQMVNLNTVLISELIYVFLAIGKGSNFLEATMNLSFIGFVIVGDFKIWNISRQRKRLTQVV 119

  Fly    92 GQLATLFHSILDSTDEWGRG-ILRRAEREAR-----NLAIL---NLSASFLDIVGALVSPLFREE 147
            .:|..|....|...:.:..| .|....|.::     ::.::   ||..:...:|......:.:.|
  Fly   120 SRLEELHPQGLAQQEPYNIGHHLSGYSRYSKFYFGMHMVLIWTYNLYWAVYYLVCDFWLGMRQFE 184

  Fly   148 RAHPFGLALP-----GVSMTSSPVYEVIYLA-----------QLPTPLLL----SMMYMPFVSLF 192
            |..|:...:|     |.|      |..:|::           ||...:|:    :::.|.|:.|.
  Fly   185 RMLPYYCWVPWDWSTGYS------YYFMYISQNIGGQACLSGQLAADMLMCALVTLVVMHFIRLS 243

  Fly   193 AGLAIFGKAMLQILVHRLGQIGGEEQSEEERFQRLASCIAYHTQVMRYVWQLNKLVANIVAVEAI 257
            |          .|..|..| ||    |.:...:.|.:.:|||..::.....:|::....:....:
  Fly   244 A----------HIESHVAG-IG----SFQHDLEFLQATVAYHQSLIHLCQDINEIFGVSLLSNFV 293

  Fly   258 IFGSIICSLLFCLNIITSPTQVISIVMYILTMLYVLFTYYNRANEICLENNRVAEAVYNVPWYEA 322
            ....|||.:.|.:.|.:....::.:|:::...:..:|.....|..:...:.::.:||||..|:.|
  Fly   294 SSSFIICFVGFQMTIGSKIDNLVMLVLFLFCAMVQVFMIATHAQRLVDASEQIGQAVYNHDWFRA 358

  Fly   323 GTRFRKTLLIFLMQTQHPMEIRVGNVYPMTLAMFQSLLNASYSYFTMLR 371
            ..|:||.|::.:.:.|.|..::......::|.....||..||.:|.:||
  Fly   359 DLRYRKMLILIIKRAQQPSRLKATMFLNISLVTVSDLLQLSYKFFALLR 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or43aNP_523647.2 7tm_6 56..364 CDD:251636 63/339 (19%)
Or85dNP_524281.1 7tm_6 84..400 CDD:251636 63/336 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466129
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.