DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or43a and Or71a

DIOPT Version :9

Sequence 1:NP_523647.2 Gene:Or43a / 35644 FlyBaseID:FBgn0026389 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_524078.2 Gene:Or71a / 39641 FlyBaseID:FBgn0036474 Length:378 Species:Drosophila melanogaster


Alignment Length:409 Identity:78/409 - (19%)
Similarity:162/409 - (39%) Gaps:93/409 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LVGINVRMWRHLAVLYP------TPG-SSWRKFAFVLPVTAMNLMQFVYLLRMWGD--------- 56
            |.|: ::.||    |:|      ||. ::|:.:|..:|.|      |:::|.:|.:         
  Fly    12 LTGV-LKWWR----LWPRKESVSTPDWTNWQAYALHVPFT------FLFVLLLWLEAIKSRDIQH 65

  Fly    57 -------------LPAFILNMFFFSAIFNALMRTW----LVIIKRRQFEEFLGQLATLFHSILDS 104
                         |...::|::.::.:...::..|    |..::.:|                 .
  Fly    66 TADVLLICLTTTALGGKVINIWKYAHVAQGILSEWSTWDLFELRSKQ-----------------E 113

  Fly   105 TDEWGRGILRRAEREARNLAIL---NLSASFLDIVGALVSPLFREERAHPFGLALPGVSMTSSPV 166
            .|.|      |.|....|...:   ..||..:..:  ::.|||......||.:..|  .....||
  Fly   114 VDMW------RFEHRRFNRVFMFYCLCSAGVIPFI--VIQPLFDIPNRLPFWMWTP--FDWQQPV 168

  Fly   167 ---YEVIYLAQLPTPLLLSMMYMPFVSLFAGLAIFGKAMLQILVHRLGQIGGEEQSEEERFQRLA 228
               |..||.|..........:.|..|:.:  |.:.....|::|..||.::..:::...|:|..| 
  Fly   169 LFWYAFIYQATTIPIACACNVTMDAVNWY--LMLHLSLCLRMLGQRLSKLQHDDKDLREKFLEL- 230

  Fly   229 SCIAYHTQVMRYVWQLNKLVANIVAVEAIIFGSIICSLLFCLNIITSPT-----QVISIVMYILT 288
              |..|.::.:....:...::.....:.::...|||..::.:.:  ||.     ...:::.|::.
  Fly   231 --IHLHQRLKQQALSIEIFISKSTFTQILVSSLIICFTIYSMQM--SPVLQDLPGFAAMMQYLVA 291

  Fly   289 ML--YVLFTYYNRANEICLENNRVAEAVYNVPWYEAGTRFRKTLLIFLMQTQHPMEIRVGNVYPM 351
            |:  .:|.|.|  .|.:....|.:.:::||..|.:...|.|:.:|:|::....|:.::.|..:.:
  Fly   292 MIMQVMLPTIY--GNAVIDSANMLTDSMYNSDWPDMNCRMRRLVLMFMVYLNRPVTLKAGGFFHI 354

  Fly   352 TLAMFQSLLNASYSYFTML 370
            .|.:|...:|.:||...:|
  Fly   355 GLPLFTKTMNQAYSLLALL 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or43aNP_523647.2 7tm_6 56..364 CDD:251636 60/346 (17%)
Or71aNP_524078.2 7tm_6 68..367 CDD:251636 60/334 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466156
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.