DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or43a and Or63a

DIOPT Version :9

Sequence 1:NP_523647.2 Gene:Or43a / 35644 FlyBaseID:FBgn0026389 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_523895.2 Gene:Or63a / 38354 FlyBaseID:FBgn0035382 Length:420 Species:Drosophila melanogaster


Alignment Length:428 Identity:79/428 - (18%)
Similarity:149/428 - (34%) Gaps:95/428 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VGIN----------VRMW------RHLAVLYPTPGSSWRKFA-FVLPV-----TAMNLMQFVYLL 51
            ||.|          :|:|      ..||.||    ..|:..| ::..:     ||...:||:   
  Fly    28 VGFNLLDPSRCGQVLRIWTIVLSVSSLASLY----GHWQMLARYIHDIPRIGETAGTALQFL--- 85

  Fly    52 RMWGDLPAFILNMFFFSAIFNALMRTWLVIIKRRQFEEFLGQLATLFHSILDSTDEWGR----GI 112
                                .::.:.|..:...||..|.|.:...  |.:|...:.:.|    .:
  Fly    86 --------------------TSIAKMWYFLFAHRQIYELLRKARC--HELLQKCELFERMSDLPV 128

  Fly   113 LRRAEREA------------RNLAILNLSASFLD---IVGALVSPLFR----EERAHPFGLALPG 158
            ::...::.            |.:.|...|...:.   .:.:.|..|:|    .:.::...|.||.
  Fly   129 IKEIRQQVESTMNRYWASTRRQILIYLYSCICITTNYFINSFVINLYRYFTKPKGSYDIMLPLPS 193

  Fly   159 V------SMTSSPVYEVIYLAQLPTPLLLSMMYMPFVSLFAGLAIFGKAMLQILVHRLGQIGGEE 217
            :      .....|.|.:....:..:..:..|..:.|..:|..|.:....:::.|...:.|...|.
  Fly   194 LYPAWEHKGLEFPYYHIQMYLETCSLYICGMCAVSFDGVFIVLCLHSVGLMRSLNQMVEQATSEL 258

  Fly   218 QSEEERFQRLASCIAYHTQVMRYVWQLNKLVANIVAVEAIIFGSIICSL------LFCLNI---I 273
            ...:.|.:.|..||..:.:|..:..::|....:|.      |...:.||      ||.:::   .
  Fly   259 VPPDRRVEYLRCCIYQYQRVANFATEVNNCFRHIT------FTQFLLSLFNWGLALFQMSVGLGN 317

  Fly   274 TSPTQVISIVMYILTMLYVLFTYYNRANEICLENNRVAEAVYNVPWYEAGTRFRKTLLIFLMQTQ 338
            .|...:|.:.||::...|.:..|..........:..:|.|.|.|.||.....||..:.:.||:|.
  Fly   318 NSSITMIRMTMYLVAAGYQIVVYCYNGQRFATASEEIANAFYQVRWYGESREFRHLIRMMLMRTN 382

  Fly   339 HPMEIRVGNVYPMTLAMFQSLLNASYSYFTMLRGVTGK 376
            ....:.|.....|:|....:::..|..||.:|:.|..|
  Fly   383 RGFRLDVSWFMQMSLPTLMAMVRTSGQYFLLLQNVNQK 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or43aNP_523647.2 7tm_6 56..364 CDD:251636 58/345 (17%)
Or63aNP_523895.2 7tm_6 76..408 CDD:251636 62/362 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465288
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.