DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or43a and Or33c

DIOPT Version :9

Sequence 1:NP_523647.2 Gene:Or43a / 35644 FlyBaseID:FBgn0026389 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_523555.1 Gene:Or33c / 34603 FlyBaseID:FBgn0026390 Length:384 Species:Drosophila melanogaster


Alignment Length:393 Identity:86/393 - (21%)
Similarity:148/393 - (37%) Gaps:82/393 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LVGINVRMW--RHL---AVLYPTPGSSWRKFAFVLPVTAMNLMQFVYLLRMWGDLPAFILNMFFF 67
            |:.|.|.:|  .||   .:|.|:....::.....|...|.:|....:|..    ||..:      
  Fly    38 LLHILVTLWFPLHLLLHLLLLPSTAEFFKNLTMSLTCVACSLKHVAHLYH----LPQIV------ 92

  Fly    68 SAIFNALMRTWLVIIKRRQFEEFLGQLATLFHSILDSTDEWGRGILR-RAEREARNLAILNLSAS 131
                              :.|..:.||.|...|  :....:.|..:. .|.|..|.|.|     |
  Fly    93 ------------------EIESLIEQLDTFIAS--EQEHRYYRDHVHCHARRFTRCLYI-----S 132

  Fly   132 FLDIVGALVSPLFREERAHPFGLALPGVSMTSSPVYEVIYLAQLPTPL-------LLSMMYMPFV 189
            |     .::..||.      ||:.:..:|..    :|::|.|..|..|       .:::.|..|.
  Fly   133 F-----GMIYALFL------FGVFVQVISGN----WELLYPAYFPFDLESNRFLGAVALGYQVFS 182

  Fly   190 SLFAGLAIFGK--------AMLQILVH----RLGQIGGEEQSEEERFQRLASCIAYHTQVMRYVW 242
            .|..|....|.        .:|...||    |:||:|..:.......|||...|..|..::|:..
  Fly   183 MLVEGFQGLGNDTYTPLTLCLLAGHVHLWSIRMGQLGYFDDETVVNHQRLLDYIEQHKLLVRFHN 247

  Fly   243 QLNKLVANIVAVEAIIFGSIICSLLFCLNIITSPTQVISIVMYIL---TMLYVLFTYYNRANEIC 304
            .:::.::.:..|:....|:.:|.::..:......|  ||:|.|::   .:...||.....|:|:.
  Fly   248 LVSRTISEVQLVQLGGCGATLCIIVSYMLFFVGDT--ISLVYYLVFFGVVCVQLFPSCYFASEVA 310

  Fly   305 LENNRVAEAVYNVPWYEAGTRFRKTLLIFLMQT--QHPMEIRVGNVYPMTLAMFQSLLNASYSYF 367
            .|..|:..|:::..||:.....|..||||...|  .....|:.|.:..:.|..|.:.|..:||.|
  Fly   311 EELERLPYAIFSSRWYDQSRDHRFDLLIFTQLTLGNRGWIIKAGGLIELNLNAFFATLKMAYSLF 375

  Fly   368 TML 370
            .::
  Fly   376 AVV 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or43aNP_523647.2 7tm_6 56..364 CDD:251636 71/332 (21%)
Or33cNP_523555.1 7tm_6 60..372 CDD:251636 75/363 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465764
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.