DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or43a and Or82a

DIOPT Version :9

Sequence 1:NP_523647.2 Gene:Or43a / 35644 FlyBaseID:FBgn0026389 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_730794.1 Gene:Or82a / 318778 FlyBaseID:FBgn0041621 Length:385 Species:Drosophila melanogaster


Alignment Length:342 Identity:72/342 - (21%)
Similarity:140/342 - (40%) Gaps:55/342 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 SAIFNALMRTWLVIIK-------RRQFEEFLGQLATLFHSILDSTDEWGRGILRRAEREARNLAI 125
            :|..:.:....|.:||       |:.|.|.:.:...:..........:..|:...||        
  Fly    62 TACLSVVFTNMLTVIKISTFLANRKDFWEMIHRFRKMHEQSASHIPRYREGLDYVAE-------- 118

  Fly   126 LNLSASFL--------DIVGA--LVSPLFRE----------ERAHPFGLALPGVSMTSSPVYEVI 170
            .|..||||        .:.|.  ::.|:.:.          ::..|..:..| .:...||.|||.
  Fly   119 ANKLASFLGRAYCVSCGLTGLYFMLGPIVKIGVCRWHGTTCDKELPMPMKFP-FNDLESPGYEVC 182

  Fly   171 YLAQLPTPLLLSMMYMPFVS----LFAGLAIFGKAMLQILVHRLGQIGGEE--QSEEERFQRLAS 229
            :|    ..:|::::.:.:.|    ||...||..:|..|.|..   ||...|  .||.:...||.|
  Fly   183 FL----YTVLVTVVVVAYASAVDGLFISFAINLRAHFQTLQR---QIENWEFPSSEPDTQIRLKS 240

  Fly   230 CIAYHTQVMRYVWQLNKLVANIVAVEAIIFGSIICSLLFCLNIITSPTQVISIVMYIL---TMLY 291
            .:.||..::....:|..:....|..:.:|....:..:::  .::|:...|:.:::|..   :::.
  Fly   241 IVEYHVLLLSLSRKLRSIYTPTVMGQFVITSLQVGVIIY--QLVTNMDSVMDLLLYASFFGSIML 303

  Fly   292 VLFTYYNRANEICLENNRVAEAVYNVPWYEAGTRFRKTLLIFLMQTQHPMEIRVGNVYPMTLAMF 356
            .||.|......|..|:.:|..||....|:.|..:.|.:|.:.::|:|..:.||.| .:..:||.|
  Fly   304 QLFIYCYGGEIIKAESLQVDTAVRLSNWHLASPKTRTSLSLIILQSQKEVLIRAG-FFVASLANF 367

  Fly   357 QSLLNASYSYFTMLRGV 373
            ..:...:.|..|:::.:
  Fly   368 VGICRTALSLITLIKSI 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or43aNP_523647.2 7tm_6 56..364 CDD:251636 70/331 (21%)
Or82aNP_730794.1 7tm_6 65..374 CDD:251636 69/327 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465658
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.