DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or43a and Or69a

DIOPT Version :9

Sequence 1:NP_523647.2 Gene:Or43a / 35644 FlyBaseID:FBgn0026389 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_996069.1 Gene:Or69a / 2768964 FlyBaseID:FBgn0041622 Length:393 Species:Drosophila melanogaster


Alignment Length:339 Identity:67/339 - (19%)
Similarity:130/339 - (38%) Gaps:48/339 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 AFILNMFFFSAIFNALMRTWLVIIKRRQFEEFLGQLATLFHSI------LDSTDEWGRGILRRAE 117
            |.:.:|..|:.:  ..:..|.::..:..||..|.:...||..|      :....|       :..
  Fly    78 ASVASMLGFTIV--GTLNLWKMLSLKTHFENLLNEFEELFQLIKHRAYRIHHYQE-------KYT 133

  Fly   118 REARNLAILNLSASFLDIVGALVSPLFREERAHPFGLALPGVSMTSSPVYEVIYLAQLP------ 176
            |..||..|.:.||    :|.....|:....|.|.......|..:.|:..|.......:|      
  Fly   134 RHIRNTFIFHTSA----VVYYNSLPILLMIREHFSNSQQLGYRIQSNTWYPWQVQGSIPGFFAAV 194

  Fly   177 --------TPLLLSMMYMPFVSLFAGLAIFGKAMLQI----LVHRLGQIGGEEQSEEERFQRLAS 229
                    |.:.:: |::.|:..|.|:      .|:|    |..:|..|.......:::.:.|  
  Fly   195 ACQIFSCQTNMCVN-MFIQFLINFFGI------QLEIHFDGLARQLETIDARNPHAKDQLKYL-- 250

  Fly   230 CIAYHTQVMRYVWQLNKLVANIVAVEAIIFGSIICSLLFCLNIITSPTQVISIVMYILTMLYVLF 294
             |.|||:::....::|:.......:...:.....|.|.|.:.:....|.:..::..:|.:.| .|
  Fly   251 -IVYHTKLLNLADRVNRSFNFTFLISLSVSMISNCFLAFSMTMFDFGTSLKHLLGLLLFITY-NF 313

  Fly   295 TYYNRANEICLENNRVAEAVYNVPWYEAGTRFRKTLLIFLMQTQHPMEIRVGNVYPMTLAMFQSL 359
            :.......:.|.:.:|..|.:...|||....:|:.|||.:|:...|...:...:.|:::..:.:.
  Fly   314 SMCRSGTHLILTSGKVLPAAFYNNWYEGDLVYRRMLLILMMRATKPYMWKTYKLAPVSITTYMAT 378

  Fly   360 LNASYSYFTMLRGV 373
            |..||..||.:|.:
  Fly   379 LKFSYQMFTCVRSL 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or43aNP_523647.2 7tm_6 56..364 CDD:251636 62/328 (19%)
Or69aNP_996069.1 7tm_6 74..383 CDD:251636 62/328 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466126
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.