DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Ad and SERPINB11

DIOPT Version :9

Sequence 1:NP_610261.1 Gene:Spn43Ad / 35639 FlyBaseID:FBgn0044011 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_001357404.1 Gene:SERPINB11 / 89778 HGNCID:14221 Length:392 Species:Homo sapiens


Alignment Length:409 Identity:89/409 - (21%)
Similarity:161/409 - (39%) Gaps:61/409 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 SVSSNRFGLRLTTKLGLTQPDANVVVSPLLIQAALSLLYAESSSEYGSQLRQALELTHA------ 91
            |.::..|.|.:..:|.......|:..|.|.:..|||::...:..|...||.:.|..:|.      
Human     5 STANVEFCLDVFKELNSNNIGDNIFFSSLSLLYALSMVLLGARGETEEQLEKVLHFSHTVDSLKP 69

  Fly    92 ---SHPKLAV-----QDFETLLTDLKQSAAIGCRLRLLSDLYAQQRFTFNFRNEFETLAARMGVG 148
               ..||.:.     .:|....:.:.|..: .|.|.:.:.||..:  |..|..::        :.
Human    70 GFKDSPKCSQAGRIHSEFGVEFSQINQPDS-NCTLSIANRLYGTK--TMAFHQQY--------LS 123

  Fly   149 CHRLSW-----------ESASNAAQDINYAFLSRSNFSLGELVSAPQLESLAEHNTPFLHVSGVT 202
            |.. .|           :|.....:.||....:::|..:..|..    :|..:.::..:.|:.:.
Human   124 CSE-KWYQARLQTVDFEQSTEETRKTINAWVENKTNGKVANLFG----KSTIDPSSVMVLVNAIY 183

  Fly   203 FRAPWAWAFDPTETQSINFFAGGNRPRLVDAMFGQHRYRYAEVPALDAQLIEVPFATADLRMLIV 267
            |:..|...|...||....|.....:...|:.|:....::.|.|.....|::|:|:....|.|:|:
Human   184 FKGQWQNKFQVRETVKSPFQLSEGKNVTVEMMYQIGTFKLAFVKEPQMQVLELPYVNNKLSMIIL 248

  Fly   268 FPNRPDGLAQLERKLAQSDLHQ--LRSQLEERKVALTLPKLRVLVHSDLKHVLEELGLAKLFTSE 330
            .|.....|.|:|::|.....|:  ..|.:.||:|.:.||:.::....:|..:|:.||:..||.. 
Human   249 LPVGIANLKQIEKQLNSGTFHEWTSSSNMMEREVEVHLPRFKLETKYELNSLLKSLGVTDLFNQ- 312

  Fly   331 VHLSEVFSSILSSSAPP----LGAVVQSGLLELQEDGGNA----DDSFSFGDLFRRALPLVINHP 387
                  ..:.||..:|.    |...:....|::.|:|..|    .||.:...|..|| ....|||
Human   313 ------VKADLSGMSPTKGLYLSKAIHKSYLDVSEEGTEAAAATGDSIAVKSLPMRA-QFKANHP 370

  Fly   388 FFYAI--GNGKTLLLSGHI 404
            |.:.|  .:..|:|..|.:
Human   371 FLFFIRHTHTNTILFCGKL 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AdNP_610261.1 SERPIN 35..404 CDD:238101 88/405 (22%)
SERPINB11NP_001357404.1 ovalbumin_like 4..392 CDD:239014 89/409 (22%)
RCL. /evidence=ECO:0000250 341..365 8/24 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.