DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Ad and SERPINA6

DIOPT Version :9

Sequence 1:NP_610261.1 Gene:Spn43Ad / 35639 FlyBaseID:FBgn0044011 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_001747.3 Gene:SERPINA6 / 866 HGNCID:1540 Length:405 Species:Homo sapiens


Alignment Length:400 Identity:94/400 - (23%)
Similarity:167/400 - (41%) Gaps:47/400 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LTLPVDG--ELLARSPASVSSNR-------------FGLRLTTKLGLTQPDANVVVSPLLIQAAL 67
            |.||..|  .:.|..|.:...|.             |...|...|....|..|:.:||:.|..||
Human    10 LWLPTSGLWTVQAMDPNAAYVNMSNHHRGLASANVDFAFSLYKHLVALSPKKNIFISPVSISMAL 74

  Fly    68 SLLYAESSSEYGSQLRQAL--ELTHASHPKLAVQDFETL-----LTDLKQSAAIGCRLRLLSDLY 125
            ::|...:.....:||.|.|  .||..|..::. |.|:.|     .:|......:|..|.|...|.
Human    75 AMLSLGTCGHTRAQLLQGLGFNLTERSETEIH-QGFQHLHQLFAKSDTSLEMTMGNALFLDGSLE 138

  Fly   126 AQQRFTFNFRNEFETLAARMGVGCHRLSWESASNAAQDINYAFLSRSNFSLGELVSAPQLESLAE 190
            ..:.|:.:.::.:|:....|       :::..:.|::.||....:::...:.:|.|.  |:|.| 
Human   139 LLESFSADIKHYYESEVLAM-------NFQDWATASRQINSYVKNKTQGKIVDLFSG--LDSPA- 193

  Fly   191 HNTPFLHVSGVTFRAPWAWAFDPTETQSINFFAGGNRPRLVDAMFGQHRYRYAEVPALDAQLIEV 255
               ..:.|:.:.|:..|...||...|:..||:........|..|.......|.....|..||:::
Human   194 ---ILVLVNYIFFKGTWTQPFDLASTREENFYVDETTVVKVPMMLQSSTISYLHDSELPCQLVQM 255

  Fly   256 PFATADLRMLIVFPNRPDGLAQLERKLAQSDLHQLRSQLEERKVALTLPKLRVLVHSDLKHVLEE 320
            .: ..:..:..:.|:: ..:..:...|::..:::..:.|...:|.|.:||:.:....||..||||
Human   256 NY-VGNGTVFFILPDK-GKMNTVIAALSRDTINRWSAGLTSSQVDLYIPKVTISGVYDLGDVLEE 318

  Fly   321 LGLAKLFTSEVHLSEVFSSILSSSAPPLGAVVQSGLLELQEDGGNADDSFSFG---DLFRRALPL 382
            :|:|.|||::.:    ||.|...:......||...:|:|.|:|  .|.:.|.|   :|..:.:.|
Human   319 MGIADLFTNQAN----FSRITQDAQLKSSKVVHKAVLQLNEEG--VDTAGSTGVTLNLTSKPIIL 377

  Fly   383 VINHPFFYAI 392
            ..|.||...|
Human   378 RFNQPFIIMI 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AdNP_610261.1 SERPIN 35..404 CDD:238101 87/380 (23%)
SERPINA6NP_001747.3 alpha-1-antitrypsin_like 42..401 CDD:239011 86/367 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.