DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Ad and SERPIN1

DIOPT Version :9

Sequence 1:NP_610261.1 Gene:Spn43Ad / 35639 FlyBaseID:FBgn0044011 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_001320925.1 Gene:SERPIN1 / 841182 AraportID:AT1G47710 Length:418 Species:Arabidopsis thaliana


Alignment Length:421 Identity:96/421 - (22%)
Similarity:166/421 - (39%) Gaps:85/421 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 SVS-SNRFGLRLTTKLGLT-QPDANVVVSPLLIQAALSLLYAESSSEYGSQLRQALELTHASH-P 94
            |:| .|:..:.|...:..| ..::||:.||..|...||::.|.|:.....|:...|:.:.... .
plant    33 SISLQNQVSMNLAKHVITTVSQNSNVIFSPASINVVLSIIAAGSAGATKDQILSFLKFSSTDQLN 97

  Fly    95 KLAVQDFETLLTDLKQSAAIGCRLRLLSDLYAQQRFTFNFRNEFETLAARMGVGCHRLSWESASN 159
            ..:.:....:|.|  .||..|.:|.:.:..:..:  :.:|:..|:.|...        |:::|||
plant    98 SFSSEIVSAVLAD--GSANGGPKLSVANGAWIDK--SLSFKPSFKQLLED--------SYKAASN 150

  Fly   160 AAQDINYAFLSRSNFSLGE-----------LVSAPQLESLAEHNTPFLHVSGVTFRAPWAWAFDP 213
            .|.     |.|::...:.|           |::....|..|:..|..:..:.:.|:..|...||.
plant   151 QAD-----FQSKAVEVIAEVNSWAEKETNGLITEVLPEGSADSMTKLIFANALYFKGTWNEKFDE 210

  Fly   214 TETQSINF-----------FAGGNRPRLVDAMFGQHRYRYAEVPALDAQLIEVPFATADLR---M 264
            :.||...|           |....:.:.|.|..|   ::...:|.|..|         |.|   |
plant   211 SLTQEGEFHLLDGNKVTAPFMTSKKKQYVSAYDG---FKVLGLPYLQGQ---------DKRQFSM 263

  Fly   265 LIVFPNRPDGLAQLERKLAQS----DLHQLRSQLEERKVALTLPKLRVLVHSDLKHVLEELGLAK 325
            ....|:..:||:.|..|:..:    |.|..|.|::.|:  ..:||.:.....|..:||:.|||..
plant   264 YFYLPDANNGLSDLLDKIVSTPGFLDNHIPRRQVKVRE--FKIPKFKFSFGFDASNVLKGLGLTS 326

  Fly   326 LFTSEVHLSEVFSSILSSSAPPLGA------VVQSGLLELQEDGGNADDSFSFGDLFRRAL---- 380
            .|:.|..|:|:..|      |.:|.      :.....:|:.|:|..| .:.|.|.:..|.|    
plant   327 PFSGEEGLTEMVES------PEMGKNLCVSNIFHKACIEVNEEGTEA-AAASAGVIKLRGLLMEE 384

  Fly   381 ---PLVINHPFFYAIGNGKT--LLLSGHIVD 406
               ..|.:|||...:....|  :|..|.:||
plant   385 DEIDFVADHPFLLVVTENITGVVLFIGQVVD 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AdNP_610261.1 SERPIN 35..404 CDD:238101 93/415 (22%)
SERPIN1NP_001320925.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.