DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Ad and AT3G45220

DIOPT Version :9

Sequence 1:NP_610261.1 Gene:Spn43Ad / 35639 FlyBaseID:FBgn0044011 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_190108.1 Gene:AT3G45220 / 823658 AraportID:AT3G45220 Length:393 Species:Arabidopsis thaliana


Alignment Length:414 Identity:90/414 - (21%)
Similarity:155/414 - (37%) Gaps:114/414 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 ANVVVSPLLIQAALSLLYAESSSEYGSQLRQALELTHASHPKLAVQDFETLLTDLKQSAAIGCRL 118
            :|:|.||:.|...|.|:.|.|:.....|:        .|...|...|:...:.....|.|:...:
plant    29 SNLVFSPMSINVLLCLIAAGSNCVTKEQI--------LSFIMLPSSDYLNAVLAKTVSVALNDGM 85

  Fly   119 RLLSDLYAQQRF------TFNFRNEFETLAAR-MGVGCHRLSWESASNAAQDIN----YAFLSRS 172
            . .|||:....:      :.:|:..|:.|... ....|:::.:  |:..|:.||    :|.: .:
plant    86 E-RSDLHLSTAYGVWIDKSLSFKPSFKDLLENSYNATCNQVDF--ATKPAEVINEVNAWAEV-HT 146

  Fly   173 NFSLGELVSAPQLESLAEHNTPFLHVSGVTFRAPWAWAFDPTETQSINFFAGGNRPRLVDAMFGQ 237
            |..:.|::|...::::.|  :..:..:.|.|:..|:..||...|:|.:|.               
plant   147 NGLIKEILSDDSIKTIRE--SMLILANAVYFKGAWSKKFDAKLTKSYDFH--------------- 194

  Fly   238 HRYRYAEVPALDAQLIEVPFAT---------------------ADLR---MLIVFPNRPDGLAQL 278
                     .||..:::|||.|                     .|.|   |.|..||..|||..|
plant   195 ---------LLDGTMVKVPFMTNYKKQYLEYYDGFKVLRLPYVEDQRQFAMYIYLPNDRDGLPTL 250

  Fly   279 ERKLAQS----DLHQLRSQLEERKVALTLPKLRVLVHSDLKHVLEELGLAKLFTSEVH--LSEVF 337
            ..:::..    |.|..|.::...  |..:||.:.........||:|:||...||   |  |:|: 
plant   251 LEEISSKPRFLDNHIPRQRILTE--AFKIPKFKFSFEFKASDVLKEMGLTLPFT---HGSLTEM- 309

  Fly   338 SSILSSSAPP---------LGAVVQSGLLELQEDGGNA---------DDSFSFGDLFRRALPLVI 384
              :.|.|.|.         :..|.....:|:.|:|..|         .|....||       .|.
plant   310 --VESPSIPENLCVAENLFVSNVFHKACIEVDEEGTEAAAVSVASMTKDMLLMGD-------FVA 365

  Fly   385 NHPFFYAIGNGKT--LLLSGHIVD 406
            :|||.:.:...|:  :|..|.::|
plant   366 DHPFLFTVREEKSGVILFMGQVLD 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AdNP_610261.1 SERPIN 35..404 CDD:238101 89/410 (22%)
AT3G45220NP_190108.1 plant_SERPIN 8..390 CDD:238998 90/414 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.