DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Ad and AT2G35580

DIOPT Version :9

Sequence 1:NP_610261.1 Gene:Spn43Ad / 35639 FlyBaseID:FBgn0044011 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_181101.1 Gene:AT2G35580 / 818123 AraportID:AT2G35580 Length:374 Species:Arabidopsis thaliana


Alignment Length:407 Identity:87/407 - (21%)
Similarity:146/407 - (35%) Gaps:112/407 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 LGLTQPDANVVVSPLLIQAALSLLYAESSSEYGSQLRQALELTHASHPKLAVQDFETLLTDLKQS 111
            |.||.|..||:         ||::.|.|..:..:..:....|..:|..||.....|.:.|.|..|
plant    29 LRLTAPLINVI---------LSIIAASSPGDTDTADKIVSLLQASSTDKLHAVSSEIVTTVLADS 84

  Fly   112 AAI-GCRLRLLSDLYAQQRFTFNFRNEFETLAARMGVGCHRLSWESASNAA----------QDIN 165
            .|. |..:...:.|:.::  |.|....|:.|...        |:::|.|..          :::|
plant    85 TASGGPTISAANGLWIEK--TLNVEPSFKDLLLN--------SYKAAFNRVDFRTKADEVNREVN 139

  Fly   166 YAFLSRSNFSLGELV-SAPQLESLAEHNTPFLHVSGVTFRAPWAWAFDPTETQSINFFAGGNRPR 229
            .....::|..:..|: |.|:...|.:|    :..:.:.|...|...|||:.|:..:|.       
plant   140 SWVEKQTNGLITNLLPSNPKSAPLTDH----IFANALFFNGRWDSQFDPSLTKDSDFH------- 193

  Fly   230 LVDAMFGQHRYRYAEVPALDAQLIEVPFATA------------------------DLR---MLIV 267
                             .||...:.|||.|.                        |.|   |.|.
plant   194 -----------------LLDGTKVRVPFMTGASCRYTHVYEGFKVINLQYRRGREDSRSFSMQIY 241

  Fly   268 FPNRPDGLAQLERKLAQSDLHQLRSQLEERKVALTLPKLRVLVHSDLKHVLEELGLAKL-FTSEV 331
            .|:..|||..:..:||.:     |..|::.:|   ||.     ||   .|::||.:.:. |....
plant   242 LPDEKDGLPSMLERLAST-----RGFLKDNEV---LPS-----HS---AVIKELKIPRFKFDFAF 290

  Fly   332 HLSEVFSSILSSSAPPLGAVVQSGLLELQEDGGNADDSFSFGDLFRRALP-----LVINHPFFYA 391
            ..||.....  ....||..::....:|:.|.|..|..:.:|..:..|..|     .|.:|||.:.
plant   291 EASEALKGF--GLVVPLSMIMHKSCIEVDEVGSKAAAAAAFRGIGCRRPPPEKHDFVADHPFLFI 353

  Fly   392 IGNGKT--LLLSGHIVD 406
            :...::  :|..|.::|
plant   354 VKEYRSGLVLFLGQVMD 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AdNP_610261.1 SERPIN 35..404 CDD:238101 86/403 (21%)
AT2G35580NP_181101.1 plant_SERPIN 8..371 CDD:238998 87/407 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.