DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Ad and Serpine3

DIOPT Version :9

Sequence 1:NP_610261.1 Gene:Spn43Ad / 35639 FlyBaseID:FBgn0044011 Length:407 Species:Drosophila melanogaster
Sequence 2:XP_006252257.2 Gene:Serpine3 / 691375 RGDID:1585042 Length:413 Species:Rattus norvegicus


Alignment Length:397 Identity:86/397 - (21%)
Similarity:139/397 - (35%) Gaps:57/397 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 SPAS----VSSNRFGLRLTTKLGLTQPDANVVVSPLLIQAALSLLYAESSSEYGSQLRQALELTH 90
            ||.|    :....|.|.|...........|.|:||..:..:|.:|...:....|.||.:||..| 
  Rat    22 SPLSEGLWLLKTEFALHLYQSAAAETNGTNFVISPASVSLSLEILQFAARGNTGWQLAEALGYT- 85

  Fly    91 ASHPKLAVQDF-ETLLTDLKQSA-AIGCRLRLLSDLYAQQRFTFNFRNEFETLAARMGVGCHRLS 153
            ...|:  |::| .|:...|..|: .||..|..                   ||..:.|.......
  Rat    86 VQDPR--VREFLHTVYITLHNSSQGIGMELAC-------------------TLFMQTGTSLSPCF 129

  Fly   154 WESASN-AAQDINYAFLSRSNF------------SLGELVSAPQLESLAEHNTPFLHVSGVTFRA 205
            .|..|. |...:..|..|..|.            |.||...:|........:|....||.:||::
  Rat   130 VEQVSRWANSSLELADFSEPNTTTMEASKGTTRPSTGEGPGSPLWGRAGALSTQLSIVSTMTFQS 194

  Fly   206 PWAWAFDPTETQSINFFAGGNRPRLVDAM-------FGQHRYRYAEVPALDAQLIEVPFATADLR 263
            .|...|.....|.:.|.........|.||       :||    :.:.......::|:.:......
  Rat   195 SWQQRFSSVALQPLPFTCAHGLVLQVPAMHQVAEVSYGQ----FQDAAGHKVDVLELLYLGRVAS 255

  Fly   264 MLIVFP-NRPDGLAQLERKLAQSDLHQLRSQLEERKVALTLPKLRVLVHSDLKHVLEELGLAKLF 327
            :|:|.| ::...|..:|..|....:|...::|:..::.:.||:.|:....|||.:|...|:..||
  Rat   256 LLLVLPQDKGTPLDHIEPHLTARVIHLWTTRLKRARMDVFLPRFRIQNQFDLKSILRSWGITDLF 320

  Fly   328 TSEVHLSEVFSSILSSSAPPLGAVVQSGLLELQEDGGNADDSFSFGDLFRRALP-LVINHPFFYA 391
            ..   |......|.......:..|.....:||.|:|..:..:.:...|.|...| ...:.||.:.
  Rat   321 DP---LKANLKGISGRDGFYVSEVTHKAKMELSEEGTKSCAATAVLLLRRSRTPAFKADRPFIFL 382

  Fly   392 IGNGKTL 398
            :....|:
  Rat   383 LREHNTV 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AdNP_610261.1 SERPIN 35..404 CDD:238101 83/388 (21%)
Serpine3XP_006252257.2 serpin 20..400 CDD:422956 86/397 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.