DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn43Ad and SERPINA7

DIOPT Version :9

Sequence 1:NP_610261.1 Gene:Spn43Ad / 35639 FlyBaseID:FBgn0044011 Length:407 Species:Drosophila melanogaster
Sequence 2:XP_006724746.1 Gene:SERPINA7 / 6906 HGNCID:11583 Length:425 Species:Homo sapiens


Alignment Length:368 Identity:81/368 - (22%)
Similarity:150/368 - (40%) Gaps:69/368 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 ASVSSNRFGLRLTTKLGLTQPDANVVVSPLLIQAALSLLYAESSSEYGSQLRQALELTHASHPKL 96
            :|:::: |...|..:..:..||.|:..||:.|.|||.:|...:.....:::.:.|.......|.:
Human    43 SSINAD-FAFNLYRRFTVETPDKNIFFSPVSISAALVMLSFGACCSTQTEIVETLGFNLTDTPMV 106

  Fly    97 AVQ-DFETLLTDLK-----------QSAAIGCRL----RLLSD---LYAQQRFTFNFRNEFETLA 142
            .:| .|:.|:..|.           .:..||..|    :.|:|   ||..:.|:.:|.|      
Human   107 EIQHGFQHLICSLNFPKKELELQIGNALFIGKHLKPLAKFLNDVKTLYETEVFSTDFSN------ 165

  Fly   143 ARMGVGCHRLSWESASNAAQDINYAFLSRSNFSL---GELVSAPQLESLAEHNTPFLHVSGVTFR 204
                          .|.|.|:||      |:..:   |::|..  ::.| :.||..:.|:.:.|:
Human   166 --------------ISAAKQEIN------SHVEMQTKGKVVGL--IQDL-KPNTIMVLVNYIHFK 207

  Fly   205 APWAWAFDPTETQ-SINFFAGGNRPRLVDAMFGQHRYRYAEVPALDAQLIEVPFATADLRMLIVF 268
            |.||..|||::|: |.:|.........|..|....:|.:.....|:..::::.::...| .|.|.
Human   208 AQWANPFDPSKTEDSSSFLIDKTTTVQVPMMHQMEQYYHLVDMELNCTVLQMDYSKNAL-ALFVL 271

  Fly   269 PNRPDGLAQLERKLAQSDLHQLRSQLEERKVALTLPKLRVLVHSDLKHVLEELGLAKLFTSEVHL 333
            | :...:..:|..::...|.:....|::..|.|.:||..:....||...|.::|:...::.... 
Human   272 P-KEGQMESVEAAMSSKTLKKWNRLLQKGWVDLFVPKFSISATYDLGATLLKMGIQHAYSENAD- 334

  Fly   334 SEVFSSI-----LSSSAPPLGAVV-----QSGLLELQEDGGNA 366
               ||.:     |..|..|.|.|:     ...:|.:.|.|..|
Human   335 ---FSGLTEDNGLKLSNRPAGFVLPTQAAHKAVLHIGEKGTEA 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn43AdNP_610261.1 SERPIN 35..404 CDD:238101 80/365 (22%)
SERPINA7XP_006724746.1 alpha-1-antitrypsin_like 46..419 CDD:239011 80/365 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.